Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1694229..1694877 | Replicon | chromosome |
| Accession | NZ_CP118863 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NTP66_RS07295 | Protein ID | WP_094961724.1 |
| Coordinates | 1694692..1694877 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NTP66_RS07290 | Protein ID | WP_094961723.1 |
| Coordinates | 1694229..1694642 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS07265 | 1689544..1690680 | - | 1137 | WP_180359534.1 | M4 family metallopeptidase | - |
| NTP66_RS07270 | 1690839..1691756 | - | 918 | WP_140172324.1 | oxygen-dependent coproporphyrinogen oxidase | - |
| NTP66_RS07275 | 1691893..1692324 | + | 432 | WP_109911483.1 | GNAT family acetyltransferase | - |
| NTP66_RS07280 | 1692416..1693021 | + | 606 | WP_140172325.1 | RpoE-regulated lipoprotein | - |
| NTP66_RS07285 | 1693264..1694163 | + | 900 | WP_094961722.1 | Dyp-type peroxidase | - |
| NTP66_RS07290 | 1694229..1694642 | - | 414 | WP_094961723.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NTP66_RS07295 | 1694692..1694877 | - | 186 | WP_094961724.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NTP66_RS07300 | 1695200..1696222 | + | 1023 | WP_140172326.1 | sulfate ABC transporter substrate-binding protein | - |
| NTP66_RS07305 | 1696222..1697052 | + | 831 | WP_004264883.1 | sulfate/thiosulfate ABC transporter permease CysT | - |
| NTP66_RS07310 | 1697052..1697912 | + | 861 | WP_200129238.1 | sulfate/thiosulfate ABC transporter permease CysW | - |
| NTP66_RS07315 | 1697915..1699003 | + | 1089 | WP_094961726.1 | sulfate/thiosulfate ABC transporter ATP-binding protein CysA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6992.20 Da Isoelectric Point: 11.0146
>T273514 WP_094961724.1 NZ_CP118863:c1694877-1694692 [Providencia rettgeri]
VQSSELINILQKNGWKLERIKGSHHQFSHPHFSIVITVPHPQKDLKIGTLNHILKAAKLKH
VQSSELINILQKNGWKLERIKGSHHQFSHPHFSIVITVPHPQKDLKIGTLNHILKAAKLKH
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15362.31 Da Isoelectric Point: 4.6719
>AT273514 WP_094961723.1 NZ_CP118863:c1694642-1694229 [Providencia rettgeri]
MLYTAFIEIDNDGSASGWFPDIEGCTFAGSNIEEAYAEAKSAIDAHFELLSEKGFEIPLSKSQQTLLNPIQPEYAHGIWL
FVDVDMDKYDGRTERINITLPHRLLHRIDALVKVNPEYGSRSGFIAAAARKELKKTD
MLYTAFIEIDNDGSASGWFPDIEGCTFAGSNIEEAYAEAKSAIDAHFELLSEKGFEIPLSKSQQTLLNPIQPEYAHGIWL
FVDVDMDKYDGRTERINITLPHRLLHRIDALVKVNPEYGSRSGFIAAAARKELKKTD
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|