Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1484147..1484804 | Replicon | chromosome |
| Accession | NZ_CP118863 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A264VM08 |
| Locus tag | NTP66_RS06365 | Protein ID | WP_036958456.1 |
| Coordinates | 1484394..1484804 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | D4C097 |
| Locus tag | NTP66_RS06360 | Protein ID | WP_004261864.1 |
| Coordinates | 1484147..1484413 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS06345 | 1481144..1482040 | - | 897 | WP_180359477.1 | hypothetical protein | - |
| NTP66_RS06350 | 1482284..1482904 | - | 621 | WP_200129308.1 | HD domain-containing protein | - |
| NTP66_RS06355 | 1482916..1483899 | - | 984 | WP_140170983.1 | tRNA-modifying protein YgfZ | - |
| NTP66_RS06360 | 1484147..1484413 | + | 267 | WP_004261864.1 | FAD assembly factor SdhE | Antitoxin |
| NTP66_RS06365 | 1484394..1484804 | + | 411 | WP_036958456.1 | protein YgfX | Toxin |
| NTP66_RS06370 | 1484915..1485433 | - | 519 | WP_140170981.1 | flavodoxin FldB | - |
| NTP66_RS06375 | 1485551..1486453 | + | 903 | WP_004261814.1 | site-specific tyrosine recombinase XerD | - |
| NTP66_RS06380 | 1486475..1487179 | + | 705 | WP_140170979.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NTP66_RS06385 | 1487189..1488922 | + | 1734 | WP_140170977.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15568.53 Da Isoelectric Point: 10.7733
>T273513 WP_036958456.1 NZ_CP118863:1484394-1484804 [Providencia rettgeri]
VVLWKSNLSISWKTQLFSTCVHGVIGMFLLLAPWSPGNSMIWLPLLVVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWRILKAPWLTRYGILLTLEALQGKPQKLHLWVAKDALSEENWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCVHGVIGMFLLLAPWSPGNSMIWLPLLVVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWRILKAPWLTRYGILLTLEALQGKPQKLHLWVAKDALSEENWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A264VM08 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A345M2Q5 |