Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 883716..884254 | Replicon | chromosome |
| Accession | NZ_CP118863 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NTP66_RS03770 | Protein ID | WP_140172124.1 |
| Coordinates | 883964..884254 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NTP66_RS03765 | Protein ID | WP_140172123.1 |
| Coordinates | 883716..883967 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS03750 | 880129..881148 | + | 1020 | WP_004905387.1 | erythrose-4-phosphate dehydrogenase | - |
| NTP66_RS03755 | 881241..882404 | + | 1164 | WP_004905385.1 | phosphoglycerate kinase | - |
| NTP66_RS03760 | 882464..883540 | + | 1077 | WP_094962157.1 | class II fructose-bisphosphate aldolase | - |
| NTP66_RS03765 | 883716..883967 | + | 252 | WP_140172123.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NTP66_RS03770 | 883964..884254 | + | 291 | WP_140172124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NTP66_RS03775 | 884249..884605 | - | 357 | WP_140172125.1 | nuclear transport factor 2 family protein | - |
| NTP66_RS03780 | 884602..885459 | - | 858 | WP_180359520.1 | LysR substrate-binding domain-containing protein | - |
| NTP66_RS03785 | 885544..886230 | + | 687 | WP_140172127.1 | ankyrin repeat domain-containing protein | - |
| NTP66_RS03790 | 886272..886697 | + | 426 | WP_282555705.1 | nucleoside deaminase | - |
| NTP66_RS03795 | 886694..887875 | + | 1182 | WP_096864804.1 | cyanate transporter | - |
| NTP66_RS03800 | 887972..888841 | + | 870 | WP_140172129.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11124.23 Da Isoelectric Point: 10.7261
>T273512 WP_140172124.1 NZ_CP118863:883964-884254 [Providencia rettgeri]
MTGFYKVKFRDDAAKEWKKLGATIQKQFAKKLKLLIENPHIPSARLSGLQNCYKIKLKASGYRLVYEVVDNQLIIIVVTV
GKRNRNEVYDIAKKRL
MTGFYKVKFRDDAAKEWKKLGATIQKQFAKKLKLLIENPHIPSARLSGLQNCYKIKLKASGYRLVYEVVDNQLIIIVVTV
GKRNRNEVYDIAKKRL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|