Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 865226..865872 | Replicon | chromosome |
| Accession | NZ_CP118863 | ||
| Organism | Providencia rettgeri strain 12100 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | B6XA97 |
| Locus tag | NTP66_RS03680 | Protein ID | WP_004905417.1 |
| Coordinates | 865226..865429 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | D4C184 |
| Locus tag | NTP66_RS03685 | Protein ID | WP_004905413.1 |
| Coordinates | 865504..865872 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTP66_RS03655 | 861301..861639 | + | 339 | WP_004905421.1 | P-II family nitrogen regulator | - |
| NTP66_RS03660 | 861689..862936 | + | 1248 | WP_227528974.1 | ammonium transporter AmtB | - |
| NTP66_RS03665 | 863075..863944 | - | 870 | WP_109911901.1 | acyl-CoA thioesterase II | - |
| NTP66_RS03670 | 864184..864642 | + | 459 | WP_140172116.1 | YbaY family lipoprotein | - |
| NTP66_RS03680 | 865226..865429 | - | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
| NTP66_RS03685 | 865504..865872 | - | 369 | WP_004905413.1 | Hha toxicity modulator TomB | Antitoxin |
| NTP66_RS03690 | 866396..867766 | - | 1371 | WP_136135575.1 | murein transglycosylase D | - |
| NTP66_RS03695 | 867848..868603 | - | 756 | WP_140172117.1 | hydroxyacylglutathione hydrolase | - |
| NTP66_RS03700 | 868644..869378 | + | 735 | WP_094962149.1 | methyltransferase domain-containing protein | - |
| NTP66_RS03705 | 869375..869845 | - | 471 | WP_004905405.1 | ribonuclease HI | - |
| NTP66_RS03710 | 869900..870661 | + | 762 | WP_140172118.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T273511 WP_004905417.1 NZ_CP118863:c865429-865226 [Providencia rettgeri]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14085.04 Da Isoelectric Point: 4.4915
>AT273511 WP_004905413.1 NZ_CP118863:c865872-865504 [Providencia rettgeri]
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSPQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWEAMNHSLVAVLDDDLKCLTSKT
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSPQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWEAMNHSLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A291E6Q2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6G6Q6D9 |