Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2015924..2016717 | Replicon | chromosome |
| Accession | NZ_CP118856 | ||
| Organism | Mammaliicoccus lentus strain 7046 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | PYH59_RS10200 | Protein ID | WP_204179283.1 |
| Coordinates | 2016253..2016717 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | PYH59_RS10195 | Protein ID | WP_058591554.1 |
| Coordinates | 2015924..2016241 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH59_RS10140 (PYH59_10140) | 2011569..2012073 | - | 505 | Protein_1968 | single-stranded DNA-binding protein | - |
| PYH59_RS10145 (PYH59_10145) | 2012070..2012729 | - | 660 | WP_096791149.1 | ERF family protein | - |
| PYH59_RS10150 (PYH59_10150) | 2012730..2013215 | - | 486 | WP_107602488.1 | siphovirus Gp157 family protein | - |
| PYH59_RS10155 (PYH59_10155) | 2013208..2013477 | - | 270 | WP_107610866.1 | hypothetical protein | - |
| PYH59_RS10160 (PYH59_10160) | 2013480..2013740 | - | 261 | WP_204177273.1 | hypothetical protein | - |
| PYH59_RS10165 (PYH59_10165) | 2013830..2014105 | - | 276 | WP_282821291.1 | hypothetical protein | - |
| PYH59_RS10170 (PYH59_10170) | 2014106..2014345 | - | 240 | WP_282821292.1 | hypothetical protein | - |
| PYH59_RS10175 (PYH59_10175) | 2014346..2014522 | - | 177 | WP_282821294.1 | hypothetical protein | - |
| PYH59_RS10180 (PYH59_10180) | 2014519..2014740 | - | 222 | WP_282821295.1 | hypothetical protein | - |
| PYH59_RS10185 (PYH59_10185) | 2014753..2015529 | - | 777 | WP_243476629.1 | phage antirepressor | - |
| PYH59_RS10190 (PYH59_10190) | 2015541..2015771 | - | 231 | WP_204179321.1 | helix-turn-helix transcriptional regulator | - |
| PYH59_RS10195 (PYH59_10195) | 2015924..2016241 | + | 318 | WP_058591554.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PYH59_RS10200 (PYH59_10200) | 2016253..2016717 | + | 465 | WP_204179283.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| PYH59_RS10205 (PYH59_10205) | 2016731..2017381 | + | 651 | WP_282821300.1 | hypothetical protein | - |
| PYH59_RS10210 (PYH59_10210) | 2017441..2018484 | + | 1044 | WP_282821302.1 | tyrosine-type recombinase/integrase | - |
| PYH59_RS10215 (PYH59_10215) | 2018559..2019956 | - | 1398 | WP_017000941.1 | Fe-S cluster assembly protein SufB | - |
| PYH59_RS10220 (PYH59_10220) | 2020003..2020443 | - | 441 | WP_064211459.1 | SUF system NifU family Fe-S cluster assembly protein | - |
| PYH59_RS10225 (PYH59_10225) | 2020433..2021698 | - | 1266 | WP_174700894.1 | cysteine desulfurase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1964415..2019956 | 55541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18356.25 Da Isoelectric Point: 6.8462
>T273510 WP_204179283.1 NZ_CP118856:2016253-2016717 [Mammaliicoccus lentus]
MGKLEELILEYDDKLIIEECTLKRNLKGYYTDGVILLEKKLNNKVKLETFAEELAHHKITYGDITDQEILMNKKYEIKAR
RYGYELIISLDGIISAYLHGVHNLYEMAEFFEVTEKYIKYTLRHYKAKYGISTYHNGYVIKFEPLQVFKHIEFN
MGKLEELILEYDDKLIIEECTLKRNLKGYYTDGVILLEKKLNNKVKLETFAEELAHHKITYGDITDQEILMNKKYEIKAR
RYGYELIISLDGIISAYLHGVHNLYEMAEFFEVTEKYIKYTLRHYKAKYGISTYHNGYVIKFEPLQVFKHIEFN
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|