Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2015924..2016717 Replicon chromosome
Accession NZ_CP118856
Organism Mammaliicoccus lentus strain 7046

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag PYH59_RS10200 Protein ID WP_204179283.1
Coordinates 2016253..2016717 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag PYH59_RS10195 Protein ID WP_058591554.1
Coordinates 2015924..2016241 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH59_RS10140 (PYH59_10140) 2011569..2012073 - 505 Protein_1968 single-stranded DNA-binding protein -
PYH59_RS10145 (PYH59_10145) 2012070..2012729 - 660 WP_096791149.1 ERF family protein -
PYH59_RS10150 (PYH59_10150) 2012730..2013215 - 486 WP_107602488.1 siphovirus Gp157 family protein -
PYH59_RS10155 (PYH59_10155) 2013208..2013477 - 270 WP_107610866.1 hypothetical protein -
PYH59_RS10160 (PYH59_10160) 2013480..2013740 - 261 WP_204177273.1 hypothetical protein -
PYH59_RS10165 (PYH59_10165) 2013830..2014105 - 276 WP_282821291.1 hypothetical protein -
PYH59_RS10170 (PYH59_10170) 2014106..2014345 - 240 WP_282821292.1 hypothetical protein -
PYH59_RS10175 (PYH59_10175) 2014346..2014522 - 177 WP_282821294.1 hypothetical protein -
PYH59_RS10180 (PYH59_10180) 2014519..2014740 - 222 WP_282821295.1 hypothetical protein -
PYH59_RS10185 (PYH59_10185) 2014753..2015529 - 777 WP_243476629.1 phage antirepressor -
PYH59_RS10190 (PYH59_10190) 2015541..2015771 - 231 WP_204179321.1 helix-turn-helix transcriptional regulator -
PYH59_RS10195 (PYH59_10195) 2015924..2016241 + 318 WP_058591554.1 helix-turn-helix transcriptional regulator Antitoxin
PYH59_RS10200 (PYH59_10200) 2016253..2016717 + 465 WP_204179283.1 ImmA/IrrE family metallo-endopeptidase Toxin
PYH59_RS10205 (PYH59_10205) 2016731..2017381 + 651 WP_282821300.1 hypothetical protein -
PYH59_RS10210 (PYH59_10210) 2017441..2018484 + 1044 WP_282821302.1 tyrosine-type recombinase/integrase -
PYH59_RS10215 (PYH59_10215) 2018559..2019956 - 1398 WP_017000941.1 Fe-S cluster assembly protein SufB -
PYH59_RS10220 (PYH59_10220) 2020003..2020443 - 441 WP_064211459.1 SUF system NifU family Fe-S cluster assembly protein -
PYH59_RS10225 (PYH59_10225) 2020433..2021698 - 1266 WP_174700894.1 cysteine desulfurase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1964415..2019956 55541


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(31-122)

Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18356.25 Da        Isoelectric Point: 6.8462

>T273510 WP_204179283.1 NZ_CP118856:2016253-2016717 [Mammaliicoccus lentus]
MGKLEELILEYDDKLIIEECTLKRNLKGYYTDGVILLEKKLNNKVKLETFAEELAHHKITYGDITDQEILMNKKYEIKAR
RYGYELIISLDGIISAYLHGVHNLYEMAEFFEVTEKYIKYTLRHYKAKYGISTYHNGYVIKFEPLQVFKHIEFN

Download         Length: 465 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 12244.78 Da        Isoelectric Point: 7.0191

>AT273510 WP_058591554.1 NZ_CP118856:2015924-2016241 [Mammaliicoccus lentus]
MTFSKRLKESRKKQGLTLSELGNRINKTEATIQRYESGNIKNLKNDTIEELATALNVSPAYLMGWEDNPKQTTRAAHLEG
EDLTDEEWDELDRYVEFLKLKRNKK

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References