Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 744992..745531 | Replicon | chromosome |
| Accession | NZ_CP118850 | ||
| Organism | Mammaliicoccus lentus strain 7047 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A178P0V5 |
| Locus tag | PYH49_RS03720 | Protein ID | WP_016999692.1 |
| Coordinates | 745160..745531 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A4Y9KBD3 |
| Locus tag | PYH49_RS03715 | Protein ID | WP_016999693.1 |
| Coordinates | 744992..745159 (+) | Length | 56 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH49_RS03690 (PYH49_03690) | 740853..741332 | + | 480 | WP_282822110.1 | PH domain-containing protein | - |
| PYH49_RS03695 (PYH49_03695) | 741322..742854 | + | 1533 | WP_103268922.1 | PH domain-containing protein | - |
| PYH49_RS03700 (PYH49_03700) | 742844..743344 | + | 501 | WP_064204141.1 | PH domain-containing protein | - |
| PYH49_RS03705 (PYH49_03705) | 743341..743709 | + | 369 | WP_064204140.1 | holo-ACP synthase | - |
| PYH49_RS03710 (PYH49_03710) | 743757..744905 | + | 1149 | WP_103268921.1 | alanine racemase | - |
| PYH49_RS03715 (PYH49_03715) | 744992..745159 | + | 168 | WP_016999693.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYH49_RS03720 (PYH49_03720) | 745160..745531 | + | 372 | WP_016999692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYH49_RS03725 (PYH49_03725) | 745635..746639 | + | 1005 | WP_064204137.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYH49_RS03730 (PYH49_03730) | 746712..747038 | + | 327 | WP_016999690.1 | anti-sigma factor antagonist | - |
| PYH49_RS03735 (PYH49_03735) | 747040..747516 | + | 477 | WP_016999689.1 | anti-sigma B factor RsbW | - |
| PYH49_RS03740 (PYH49_03740) | 747491..748261 | + | 771 | WP_103268920.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13662.79 Da Isoelectric Point: 9.8460
>T273506 WP_016999692.1 NZ_CP118850:745160-745531 [Mammaliicoccus lentus]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A178P0V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Y9KBD3 |