Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2149959..2150498 | Replicon | chromosome |
| Accession | NZ_CP118848 | ||
| Organism | Mammaliicoccus lentus strain 7048 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A178P0V5 |
| Locus tag | PYH69_RS10905 | Protein ID | WP_016999692.1 |
| Coordinates | 2149959..2150330 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A4Y9KBD3 |
| Locus tag | PYH69_RS10910 | Protein ID | WP_016999693.1 |
| Coordinates | 2150331..2150498 (-) | Length | 56 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH69_RS10885 (PYH69_10885) | 2147229..2147999 | - | 771 | WP_016999688.1 | RNA polymerase sigma factor SigB | - |
| PYH69_RS10890 (PYH69_10890) | 2147974..2148450 | - | 477 | WP_016999689.1 | anti-sigma B factor RsbW | - |
| PYH69_RS10895 (PYH69_10895) | 2148452..2148778 | - | 327 | WP_016999690.1 | anti-sigma factor antagonist | - |
| PYH69_RS10900 (PYH69_10900) | 2148851..2149855 | - | 1005 | WP_016999691.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYH69_RS10905 (PYH69_10905) | 2149959..2150330 | - | 372 | WP_016999692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYH69_RS10910 (PYH69_10910) | 2150331..2150498 | - | 168 | WP_016999693.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYH69_RS10915 (PYH69_10915) | 2150585..2151733 | - | 1149 | WP_016999694.1 | alanine racemase | - |
| PYH69_RS10920 (PYH69_10920) | 2151781..2152149 | - | 369 | WP_016999695.1 | holo-ACP synthase | - |
| PYH69_RS10925 (PYH69_10925) | 2152146..2152646 | - | 501 | WP_016999696.1 | PH domain-containing protein | - |
| PYH69_RS10930 (PYH69_10930) | 2152636..2154168 | - | 1533 | WP_282861853.1 | PH domain-containing protein | - |
| PYH69_RS10935 (PYH69_10935) | 2154158..2154637 | - | 480 | WP_282861854.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13662.79 Da Isoelectric Point: 9.8460
>T273505 WP_016999692.1 NZ_CP118848:c2150330-2149959 [Mammaliicoccus lentus]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A178P0V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Y9KBD3 |