Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF-doc |
Location | 10579..11162 | Replicon | plasmid pML7049-4 |
Accession | NZ_CP118846 | ||
Organism | Staphylococcus epidermidis strain 7049 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | PYH64_RS12225 | Protein ID | WP_058703189.1 |
Coordinates | 10824..11162 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | PYH64_RS12220 | Protein ID | WP_038978304.1 |
Coordinates | 10579..10827 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH64_RS12195 (PYH64_12195) | 7654..7983 | + | 330 | WP_282872371.1 | hypothetical protein | - |
PYH64_RS12200 (PYH64_12200) | 8002..8244 | + | 243 | WP_049367793.1 | hypothetical protein | - |
PYH64_RS12205 (PYH64_12205) | 8439..9221 | + | 783 | WP_194375218.1 | hypothetical protein | - |
PYH64_RS12210 (PYH64_12210) | 9667..10212 | + | 546 | WP_058703190.1 | hypothetical protein | - |
PYH64_RS12215 (PYH64_12215) | 10266..10400 | + | 135 | WP_256948247.1 | hypothetical protein | - |
PYH64_RS12220 (PYH64_12220) | 10579..10827 | + | 249 | WP_038978304.1 | AbrB family transcriptional regulator | Antitoxin |
PYH64_RS12225 (PYH64_12225) | 10824..11162 | + | 339 | WP_058703189.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYH64_RS12230 (PYH64_12230) | 11307..11516 | - | 210 | WP_058703188.1 | hypothetical protein | - |
PYH64_RS12235 (PYH64_12235) | 12010..12855 | - | 846 | WP_000733268.1 | penicillin-hydrolyzing class A beta-lactamase BlaZ | - |
PYH64_RS12240 (PYH64_12240) | 12962..14719 | + | 1758 | WP_001096392.1 | beta-lactam sensor/signal transducer BlaR1 | - |
PYH64_RS12245 (PYH64_12245) | 14709..15089 | + | 381 | WP_001284653.1 | penicillinase repressor BlaI | - |
PYH64_RS12250 (PYH64_12250) | 15353..15931 | + | 579 | WP_002455810.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(K) / blaZ / msr(A) | - | 1..41938 | 41938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13106.20 Da Isoelectric Point: 9.6404
>T273503 WP_058703189.1 NZ_CP118846:10824-11162 [Staphylococcus epidermidis]
MSIKQFDIYYIDLDPTRGREKQKIRPCLIVNNKMTIDGTNFVWALPITNREKRYPLDIEVKTKKGLVTGVIDTLQIRALD
LNEREHNYKDELQDNLKNVVLQAIKTYLKPSS
MSIKQFDIYYIDLDPTRGREKQKIRPCLIVNNKMTIDGTNFVWALPITNREKRYPLDIEVKTKKGLVTGVIDTLQIRALD
LNEREHNYKDELQDNLKNVVLQAIKTYLKPSS
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|