273501

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1962827..1963297 Replicon chromosome
Accession NZ_CP118842
Organism Staphylococcus epidermidis strain 7049

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag PYH64_RS09250 Protein ID WP_001829569.1
Coordinates 1963109..1963297 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag PYH64_RS09245 Protein ID WP_002438963.1
Coordinates 1962827..1963084 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH64_RS09205 (PYH64_09205) 1958191..1958907 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
PYH64_RS09210 (PYH64_09210) 1959068..1959490 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
PYH64_RS09215 (PYH64_09215) 1959674..1959811 - 138 WP_162161215.1 hypothetical protein -
PYH64_RS09220 (PYH64_09220) 1959841..1960028 - 188 Protein_1782 hypothetical protein -
PYH64_RS09225 (PYH64_09225) 1960415..1960915 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
PYH64_RS09230 (PYH64_09230) 1961186..1961773 - 588 WP_001829615.1 histidine phosphatase family protein -
PYH64_RS09235 (PYH64_09235) 1961987..1962223 + 237 WP_002457224.1 hypothetical protein -
PYH64_RS09240 (PYH64_09240) 1962215..1962418 - 204 WP_001829671.1 sterile alpha motif-like domain-containing protein -
PYH64_RS09245 (PYH64_09245) 1962827..1963084 + 258 WP_002438963.1 hypothetical protein Antitoxin
PYH64_RS09250 (PYH64_09250) 1963109..1963297 + 189 WP_001829569.1 hypothetical protein Toxin
PYH64_RS09255 (PYH64_09255) 1963487..1964041 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
PYH64_RS09260 (PYH64_09260) 1964101..1964334 - 234 WP_001829664.1 hypothetical protein -
PYH64_RS09265 (PYH64_09265) 1964619..1965365 + 747 WP_001829580.1 poly-gamma-glutamate hydrolase family protein -
PYH64_RS09270 (PYH64_09270) 1965464..1965748 + 285 WP_001829635.1 hypothetical protein -
PYH64_RS09275 (PYH64_09275) 1965772..1965996 + 225 WP_001829613.1 hypothetical protein -
PYH64_RS09280 (PYH64_09280) 1966617..1966817 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage fusB - 1959674..1997064 37390
- flank IS/Tn - - 1959674..1959829 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T273501 WP_001829569.1 NZ_CP118842:1963109-1963297 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT273501 WP_002438963.1 NZ_CP118842:1962827-1963084 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References