Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 993807..994609 | Replicon | chromosome |
Accession | NZ_CP118842 | ||
Organism | Staphylococcus epidermidis strain 7049 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | PYH64_RS04830 | Protein ID | WP_002468490.1 |
Coordinates | 994430..994609 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | Q5HN82 |
Locus tag | PYH64_RS04825 | Protein ID | WP_002456349.1 |
Coordinates | 993807..994406 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH64_RS04800 (PYH64_04800) | 989018..990475 | + | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
PYH64_RS04805 (PYH64_04805) | 990468..991190 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
PYH64_RS04810 (PYH64_04810) | 991705..991842 | + | 138 | WP_064783702.1 | hypothetical protein | - |
PYH64_RS04815 (PYH64_04815) | 992052..993182 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PYH64_RS04820 (PYH64_04820) | 993179..993649 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PYH64_RS04825 (PYH64_04825) | 993807..994406 | + | 600 | WP_002456349.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PYH64_RS04830 (PYH64_04830) | 994430..994609 | + | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
PYH64_RS04835 (PYH64_04835) | 994765..995169 | + | 405 | WP_001829818.1 | hypothetical protein | - |
PYH64_RS04840 (PYH64_04840) | 995354..996739 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
PYH64_RS04845 (PYH64_04845) | 997100..997924 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
PYH64_RS04850 (PYH64_04850) | 998083..999216 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T273500 WP_002468490.1 NZ_CP118842:994430-994609 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22709.62 Da Isoelectric Point: 4.9942
>AT273500 WP_002456349.1 NZ_CP118842:993807-994406 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HY44 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E9LUD0 |