Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 744991..745530 | Replicon | chromosome |
| Accession | NZ_CP118837 | ||
| Organism | Mammaliicoccus lentus strain 7050 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A178P0V5 |
| Locus tag | PYH50_RS03730 | Protein ID | WP_016999692.1 |
| Coordinates | 745159..745530 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A4Y9KBD3 |
| Locus tag | PYH50_RS03725 | Protein ID | WP_016999693.1 |
| Coordinates | 744991..745158 (+) | Length | 56 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH50_RS03700 (PYH50_03700) | 740852..741331 | + | 480 | WP_282822110.1 | PH domain-containing protein | - |
| PYH50_RS03705 (PYH50_03705) | 741321..742853 | + | 1533 | WP_103268922.1 | PH domain-containing protein | - |
| PYH50_RS03710 (PYH50_03710) | 742843..743343 | + | 501 | WP_064204141.1 | PH domain-containing protein | - |
| PYH50_RS03715 (PYH50_03715) | 743340..743708 | + | 369 | WP_064204140.1 | holo-ACP synthase | - |
| PYH50_RS03720 (PYH50_03720) | 743756..744904 | + | 1149 | WP_103268921.1 | alanine racemase | - |
| PYH50_RS03725 (PYH50_03725) | 744991..745158 | + | 168 | WP_016999693.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYH50_RS03730 (PYH50_03730) | 745159..745530 | + | 372 | WP_016999692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYH50_RS03735 (PYH50_03735) | 745634..746638 | + | 1005 | WP_064204137.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYH50_RS03740 (PYH50_03740) | 746711..747037 | + | 327 | WP_016999690.1 | anti-sigma factor antagonist | - |
| PYH50_RS03745 (PYH50_03745) | 747039..747515 | + | 477 | WP_016999689.1 | anti-sigma B factor RsbW | - |
| PYH50_RS03750 (PYH50_03750) | 747490..748260 | + | 771 | WP_103268920.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13662.79 Da Isoelectric Point: 9.8460
>T273496 WP_016999692.1 NZ_CP118837:745159-745530 [Mammaliicoccus lentus]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A178P0V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Y9KBD3 |