Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2123296..2123825 | Replicon | chromosome |
| Accession | NZ_CP118835 | ||
| Organism | Staphylococcus aureus strain 7051 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PYH51_RS10550 | Protein ID | WP_000621175.1 |
| Coordinates | 2123296..2123658 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | PYH51_RS10555 | Protein ID | WP_000948331.1 |
| Coordinates | 2123655..2123825 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH51_RS10530 (2120274) | 2120274..2121044 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| PYH51_RS10535 (2121019) | 2121019..2121498 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| PYH51_RS10540 (2121500) | 2121500..2121826 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| PYH51_RS10545 (2121945) | 2121945..2122946 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYH51_RS10550 (2123296) | 2123296..2123658 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYH51_RS10555 (2123655) | 2123655..2123825 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYH51_RS10560 (2123910) | 2123910..2125058 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| PYH51_RS10565 (2125124) | 2125124..2125483 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| PYH51_RS10570 (2125487) | 2125487..2125978 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
| PYH51_RS10575 (2125965) | 2125965..2127548 | - | 1584 | WP_045177766.1 | PH domain-containing protein | - |
| PYH51_RS10580 (2127541) | 2127541..2128020 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| PYH51_RS10585 (2128229) | 2128229..2128789 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T273489 WP_000621175.1 NZ_CP118835:c2123658-2123296 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|