Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 837123..837600 Replicon chromosome
Accession NZ_CP118835
Organism Staphylococcus aureus strain 7051

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PYH51_RS03970 Protein ID WP_000052076.1
Coordinates 837123..837311 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PYH51_RS03975 Protein ID WP_001059690.1
Coordinates 837340..837600 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH51_RS03940 (833164) 833164..833634 + 471 WP_000824472.1 hypothetical protein -
PYH51_RS03945 (833975) 833975..834661 + 687 WP_001566557.1 thermonuclease family protein -
PYH51_RS03950 (835018) 835018..835218 + 201 WP_001059082.1 cold-shock protein -
PYH51_RS03955 (835714) 835714..835932 - 219 WP_000005886.1 hypothetical protein -
PYH51_RS03960 (835994) 835994..836278 - 285 WP_001004401.1 hypothetical protein -
PYH51_RS03965 (836366) 836366..836935 - 570 WP_045178121.1 lipoprotein N-acylation protein LnsA -
PYH51_RS03970 (837123) 837123..837311 - 189 WP_000052076.1 hypothetical protein Toxin
PYH51_RS03975 (837340) 837340..837600 - 261 WP_001059690.1 hypothetical protein Antitoxin
PYH51_RS03980 (837941) 837941..838144 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PYH51_RS03985 (838141) 838141..838377 - 237 WP_000368687.1 hypothetical protein -
PYH51_RS03990 (838602) 838602..839183 + 582 WP_001140697.1 histidine phosphatase family protein -
PYH51_RS03995 (839256) 839256..839873 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
PYH51_RS04000 (840028) 840028..840522 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
PYH51_RS04005 (840921) 840921..841343 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
PYH51_RS04010 (841491) 841491..842207 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T273481 WP_000052076.1 NZ_CP118835:c837311-837123 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT273481 WP_001059690.1 NZ_CP118835:c837600-837340 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References