Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2123298..2123827 | Replicon | chromosome |
Accession | NZ_CP118832 | ||
Organism | Staphylococcus aureus strain 7053 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PYH65_RS10555 | Protein ID | WP_000621175.1 |
Coordinates | 2123298..2123660 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | PYH65_RS10560 | Protein ID | WP_000948331.1 |
Coordinates | 2123657..2123827 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH65_RS10535 (2120276) | 2120276..2121046 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
PYH65_RS10540 (2121021) | 2121021..2121500 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
PYH65_RS10545 (2121502) | 2121502..2121828 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
PYH65_RS10550 (2121947) | 2121947..2122948 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
PYH65_RS10555 (2123298) | 2123298..2123660 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYH65_RS10560 (2123657) | 2123657..2123827 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PYH65_RS10565 (2123912) | 2123912..2125060 | - | 1149 | WP_001281154.1 | alanine racemase | - |
PYH65_RS10570 (2125126) | 2125126..2125485 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
PYH65_RS10575 (2125489) | 2125489..2125980 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
PYH65_RS10580 (2125967) | 2125967..2127550 | - | 1584 | WP_045177766.1 | PH domain-containing protein | - |
PYH65_RS10585 (2127543) | 2127543..2128022 | - | 480 | WP_001287079.1 | hypothetical protein | - |
PYH65_RS10590 (2128231) | 2128231..2128791 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T273474 WP_000621175.1 NZ_CP118832:c2123660-2123298 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|