Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1925694..1926470 | Replicon | chromosome |
Accession | NZ_CP118832 | ||
Organism | Staphylococcus aureus strain 7053 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | PYH65_RS09310 | Protein ID | WP_000031108.1 |
Coordinates | 1925694..1925846 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | PYH65_RS09315 | Protein ID | WP_001251224.1 |
Coordinates | 1925871..1926470 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH65_RS09295 (1921831) | 1921831..1922652 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
PYH65_RS09300 (1923115) | 1923115..1924500 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
PYH65_RS09305 (1924696) | 1924696..1925091 | - | 396 | WP_000901023.1 | hypothetical protein | - |
PYH65_RS09310 (1925694) | 1925694..1925846 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
PYH65_RS09315 (1925871) | 1925871..1926470 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PYH65_RS09320 (1926629) | 1926629..1927099 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PYH65_RS09325 (1927104) | 1927104..1928231 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PYH65_RS09330 (1928382) | 1928382..1929104 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
PYH65_RS09335 (1929097) | 1929097..1930554 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T273469 WP_000031108.1 NZ_CP118832:c1925846-1925694 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT273469 WP_001251224.1 NZ_CP118832:c1926470-1925871 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|