Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1925695..1926471 | Replicon | chromosome |
Accession | NZ_CP118830 | ||
Organism | Staphylococcus aureus strain 7054 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | PYH54_RS09305 | Protein ID | WP_000031108.1 |
Coordinates | 1925695..1925847 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | PYH54_RS09310 | Protein ID | WP_001251224.1 |
Coordinates | 1925872..1926471 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH54_RS09290 (1921832) | 1921832..1922653 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
PYH54_RS09295 (1923116) | 1923116..1924501 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
PYH54_RS09300 (1924697) | 1924697..1925092 | - | 396 | WP_000901023.1 | hypothetical protein | - |
PYH54_RS09305 (1925695) | 1925695..1925847 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
PYH54_RS09310 (1925872) | 1925872..1926471 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PYH54_RS09315 (1926630) | 1926630..1927100 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PYH54_RS09320 (1927105) | 1927105..1928232 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PYH54_RS09325 (1928383) | 1928383..1929105 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
PYH54_RS09330 (1929098) | 1929098..1930555 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T273454 WP_000031108.1 NZ_CP118830:c1925847-1925695 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT273454 WP_001251224.1 NZ_CP118830:c1926471-1925872 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|