Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 837125..837602 Replicon chromosome
Accession NZ_CP118830
Organism Staphylococcus aureus strain 7054

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PYH54_RS03965 Protein ID WP_000052076.1
Coordinates 837125..837313 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PYH54_RS03970 Protein ID WP_001059690.1
Coordinates 837342..837602 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH54_RS03935 (833166) 833166..833636 + 471 WP_000824472.1 hypothetical protein -
PYH54_RS03940 (833977) 833977..834663 + 687 WP_001566557.1 thermonuclease family protein -
PYH54_RS03945 (835020) 835020..835220 + 201 WP_001059082.1 cold-shock protein -
PYH54_RS03950 (835716) 835716..835934 - 219 WP_000005886.1 hypothetical protein -
PYH54_RS03955 (835996) 835996..836280 - 285 WP_001004401.1 hypothetical protein -
PYH54_RS03960 (836368) 836368..836937 - 570 WP_045178121.1 lipoprotein N-acylation protein LnsA -
PYH54_RS03965 (837125) 837125..837313 - 189 WP_000052076.1 hypothetical protein Toxin
PYH54_RS03970 (837342) 837342..837602 - 261 WP_001059690.1 hypothetical protein Antitoxin
PYH54_RS03975 (837943) 837943..838146 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PYH54_RS03980 (838143) 838143..838379 - 237 WP_000368687.1 hypothetical protein -
PYH54_RS03985 (838604) 838604..839185 + 582 WP_001140697.1 histidine phosphatase family protein -
PYH54_RS03990 (839258) 839258..839875 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
PYH54_RS03995 (840030) 840030..840524 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
PYH54_RS04000 (840923) 840923..841345 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
PYH54_RS04005 (841493) 841493..842209 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T273451 WP_000052076.1 NZ_CP118830:c837313-837125 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT273451 WP_001059690.1 NZ_CP118830:c837602-837342 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References