Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2035071..2035541 Replicon chromosome
Accession NZ_CP118820
Organism Staphylococcus epidermidis strain 7057

Toxin (Protein)


Gene name TsaT Uniprot ID A0A939NNQ7
Locus tag PYH56_RS09735 Protein ID WP_002445998.1
Coordinates 2035353..2035541 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag PYH56_RS09730 Protein ID WP_099606866.1
Coordinates 2035071..2035328 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH56_RS09695 (PYH56_09695) 2030341..2030883 - 543 WP_099606865.1 nitroreductase -
PYH56_RS09700 (PYH56_09700) 2030964..2031680 - 717 WP_002457220.1 type I 3-dehydroquinate dehydratase -
PYH56_RS09705 (PYH56_09705) 2031841..2032263 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
PYH56_RS09710 (PYH56_09710) 2032669..2033169 + 501 WP_002457222.1 GNAT family N-acetyltransferase -
PYH56_RS09715 (PYH56_09715) 2033440..2034027 - 588 WP_162151998.1 histidine phosphatase family protein -
PYH56_RS09720 (PYH56_09720) 2034241..2034477 + 237 WP_038813093.1 hypothetical protein -
PYH56_RS09725 (PYH56_09725) 2034469..2034672 - 204 WP_002457225.1 sterile alpha motif-like domain-containing protein -
PYH56_RS09730 (PYH56_09730) 2035071..2035328 + 258 WP_099606866.1 hypothetical protein Antitoxin
PYH56_RS09735 (PYH56_09735) 2035353..2035541 + 189 WP_002445998.1 hypothetical protein Toxin
PYH56_RS09740 (PYH56_09740) 2035731..2036285 + 555 WP_002475968.1 lipoprotein N-acylation protein LnsA -
PYH56_RS09745 (PYH56_09745) 2036343..2036576 - 234 WP_162151997.1 hypothetical protein -
PYH56_RS09750 (PYH56_09750) 2036790..2037536 + 747 WP_002457228.1 poly-gamma-glutamate hydrolase family protein -
PYH56_RS09755 (PYH56_09755) 2037635..2037919 + 285 WP_001829635.1 hypothetical protein -
PYH56_RS09760 (PYH56_09760) 2037944..2038168 + 225 WP_070853400.1 hypothetical protein -
PYH56_RS09765 (PYH56_09765) 2038786..2038986 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2032669..2070843 38174


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7257.95 Da        Isoelectric Point: 9.8369

>T273450 WP_002445998.1 NZ_CP118820:2035353-2035541 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKREERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10000.03 Da        Isoelectric Point: 4.5440

>AT273450 WP_099606866.1 NZ_CP118820:2035071-2035328 [Staphylococcus epidermidis]
MKLNKANVFNLIFTILFFTFNILITYNANVDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References