Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1030324..1031129 | Replicon | chromosome |
Accession | NZ_CP118820 | ||
Organism | Staphylococcus epidermidis strain 7057 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | PYH56_RS04980 | Protein ID | WP_002457885.1 |
Coordinates | 1030947..1031129 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A0E1VBD1 |
Locus tag | PYH56_RS04975 | Protein ID | WP_002446763.1 |
Coordinates | 1030324..1030923 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH56_RS04955 (PYH56_04955) | 1026049..1027506 | + | 1458 | WP_060545923.1 | ABC transporter substrate-binding protein/permease | - |
PYH56_RS04960 (PYH56_04960) | 1027499..1028221 | + | 723 | WP_002446766.1 | amino acid ABC transporter ATP-binding protein | - |
PYH56_RS04965 (PYH56_04965) | 1028569..1029699 | + | 1131 | WP_002476052.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PYH56_RS04970 (PYH56_04970) | 1029696..1030166 | + | 471 | WP_162154432.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PYH56_RS04975 (PYH56_04975) | 1030324..1030923 | + | 600 | WP_002446763.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PYH56_RS04980 (PYH56_04980) | 1030947..1031129 | + | 183 | WP_002457885.1 | SAS053 family protein | Toxin |
PYH56_RS04985 (PYH56_04985) | 1031281..1031685 | + | 405 | WP_002457884.1 | hypothetical protein | - |
PYH56_RS04990 (PYH56_04990) | 1031877..1033262 | + | 1386 | WP_002447846.1 | class II fumarate hydratase | - |
PYH56_RS04995 (PYH56_04995) | 1033738..1034220 | + | 483 | Protein_950 | transposase | - |
PYH56_RS05000 (PYH56_05000) | 1034394..1035218 | - | 825 | WP_002457882.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1033909..1034220 | 311 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7080.67 Da Isoelectric Point: 4.3016
>T273449 WP_002457885.1 NZ_CP118820:1030947-1031129 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQPHDNEVRSDFKNSK
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQPHDNEVRSDFKNSK
Download Length: 183 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22635.54 Da Isoelectric Point: 4.9942
>AT273449 WP_002446763.1 NZ_CP118820:1030324-1030923 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLGKEHAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDVSVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLGKEHAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDVSVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|