Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 889778..890307 | Replicon | chromosome |
| Accession | NZ_CP118820 | ||
| Organism | Staphylococcus epidermidis strain 7057 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A939SRT1 |
| Locus tag | PYH56_RS04165 | Protein ID | WP_002447757.1 |
| Coordinates | 889945..890307 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q5HME6 |
| Locus tag | PYH56_RS04160 | Protein ID | WP_001829931.1 |
| Coordinates | 889778..889948 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH56_RS04135 (PYH56_04135) | 885602..886081 | + | 480 | WP_038813238.1 | PH domain-containing protein | - |
| PYH56_RS04140 (PYH56_04140) | 886074..887579 | + | 1506 | WP_038813239.1 | PH domain-containing protein | - |
| PYH56_RS04145 (PYH56_04145) | 887566..888084 | + | 519 | WP_002499547.1 | PH domain-containing protein | - |
| PYH56_RS04150 (PYH56_04150) | 888123..888476 | + | 354 | WP_002486941.1 | holo-ACP synthase | - |
| PYH56_RS04155 (PYH56_04155) | 888543..889691 | + | 1149 | WP_002458690.1 | alanine racemase | - |
| PYH56_RS04160 (PYH56_04160) | 889778..889948 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYH56_RS04165 (PYH56_04165) | 889945..890307 | + | 363 | WP_002447757.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYH56_RS04170 (PYH56_04170) | 890652..891653 | + | 1002 | WP_046044500.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYH56_RS04175 (PYH56_04175) | 891753..892079 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
| PYH56_RS04180 (PYH56_04180) | 892081..892560 | + | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
| PYH56_RS04185 (PYH56_04185) | 892535..893305 | + | 771 | WP_002458689.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13483.62 Da Isoelectric Point: 9.9522
>T273448 WP_002447757.1 NZ_CP118820:889945-890307 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSDSKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSDSKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|