Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1956081..1956551 Replicon chromosome
Accession NZ_CP118814
Organism Staphylococcus epidermidis strain 7060

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag PYH74_RS09250 Protein ID WP_001829569.1
Coordinates 1956363..1956551 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag PYH74_RS09245 Protein ID WP_002438963.1
Coordinates 1956081..1956338 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH74_RS09205 (PYH74_09205) 1951447..1952163 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
PYH74_RS09210 (PYH74_09210) 1952324..1952746 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
PYH74_RS09215 (PYH74_09215) 1952930..1953067 - 138 WP_162161215.1 hypothetical protein -
PYH74_RS09220 (PYH74_09220) 1953097..1953284 - 188 Protein_1782 hypothetical protein -
PYH74_RS09225 (PYH74_09225) 1953671..1954171 + 501 WP_241526397.1 GNAT family N-acetyltransferase -
PYH74_RS09230 (PYH74_09230) 1954442..1955029 - 588 WP_001829615.1 histidine phosphatase family protein -
PYH74_RS09235 (PYH74_09235) 1955241..1955477 + 237 WP_002457224.1 hypothetical protein -
PYH74_RS09240 (PYH74_09240) 1955469..1955672 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
PYH74_RS09245 (PYH74_09245) 1956081..1956338 + 258 WP_002438963.1 hypothetical protein Antitoxin
PYH74_RS09250 (PYH74_09250) 1956363..1956551 + 189 WP_001829569.1 hypothetical protein Toxin
PYH74_RS09255 (PYH74_09255) 1956741..1957294 + 554 Protein_1789 hypothetical protein -
PYH74_RS09260 (PYH74_09260) 1957354..1957587 - 234 WP_001829664.1 hypothetical protein -
PYH74_RS09265 (PYH74_09265) 1957871..1958617 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
PYH74_RS09270 (PYH74_09270) 1958716..1959000 + 285 WP_001829635.1 hypothetical protein -
PYH74_RS09275 (PYH74_09275) 1959024..1959248 + 225 WP_001829613.1 hypothetical protein -
PYH74_RS09280 (PYH74_09280) 1959869..1960069 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage fusB - 1947055..1990294 43239
- flank IS/Tn - - 1952930..1953085 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T273446 WP_001829569.1 NZ_CP118814:1956363-1956551 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT273446 WP_002438963.1 NZ_CP118814:1956081-1956338 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References