Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 744994..745533 | Replicon | chromosome |
Accession | NZ_CP118800 | ||
Organism | Mammaliicoccus lentus strain 7066 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A178P0V5 |
Locus tag | PYH60_RS03725 | Protein ID | WP_016999692.1 |
Coordinates | 745162..745533 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A4Y9KBD3 |
Locus tag | PYH60_RS03720 | Protein ID | WP_016999693.1 |
Coordinates | 744994..745161 (+) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH60_RS03695 (PYH60_03695) | 740855..741334 | + | 480 | WP_282822110.1 | PH domain-containing protein | - |
PYH60_RS03700 (PYH60_03700) | 741324..742856 | + | 1533 | WP_103268922.1 | PH domain-containing protein | - |
PYH60_RS03705 (PYH60_03705) | 742846..743346 | + | 501 | WP_064204141.1 | PH domain-containing protein | - |
PYH60_RS03710 (PYH60_03710) | 743343..743711 | + | 369 | WP_064204140.1 | holo-ACP synthase | - |
PYH60_RS03715 (PYH60_03715) | 743759..744907 | + | 1149 | WP_103268921.1 | alanine racemase | - |
PYH60_RS03720 (PYH60_03720) | 744994..745161 | + | 168 | WP_016999693.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PYH60_RS03725 (PYH60_03725) | 745162..745533 | + | 372 | WP_016999692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYH60_RS03730 (PYH60_03730) | 745637..746641 | + | 1005 | WP_064204137.1 | PP2C family protein-serine/threonine phosphatase | - |
PYH60_RS03735 (PYH60_03735) | 746714..747040 | + | 327 | WP_016999690.1 | anti-sigma factor antagonist | - |
PYH60_RS03740 (PYH60_03740) | 747042..747518 | + | 477 | WP_016999689.1 | anti-sigma B factor RsbW | - |
PYH60_RS03745 (PYH60_03745) | 747493..748263 | + | 771 | WP_103268920.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13662.79 Da Isoelectric Point: 9.8460
>T273441 WP_016999692.1 NZ_CP118800:745162-745533 [Mammaliicoccus lentus]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A178P0V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y9KBD3 |