Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3223533..3224242 | Replicon | chromosome |
| Accession | NZ_CP118775 | ||
| Organism | Delftia tsuruhatensis strain ULwDis3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PW274_RS15215 | Protein ID | WP_126312062.1 |
| Coordinates | 3223533..3223979 (-) | Length | 149 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A072T8L1 |
| Locus tag | PW274_RS15220 | Protein ID | WP_043790233.1 |
| Coordinates | 3223976..3224242 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PW274_RS15195 (PW274_15195) | 3219131..3220345 | + | 1215 | WP_047219430.1 | ABC transporter permease | - |
| PW274_RS15200 (PW274_15200) | 3220347..3221492 | + | 1146 | WP_016453267.1 | ABC transporter permease | - |
| PW274_RS15205 (PW274_15205) | 3221556..3222185 | - | 630 | WP_126312061.1 | DUF4124 domain-containing protein | - |
| PW274_RS15210 (PW274_15210) | 3222264..3223469 | - | 1206 | WP_013801714.1 | MFS transporter | - |
| PW274_RS15215 (PW274_15215) | 3223533..3223979 | - | 447 | WP_126312062.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PW274_RS15220 (PW274_15220) | 3223976..3224242 | - | 267 | WP_043790233.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PW274_RS15225 (PW274_15225) | 3224267..3225238 | - | 972 | WP_126312063.1 | LysR family transcriptional regulator | - |
| PW274_RS15230 (PW274_15230) | 3225315..3226199 | + | 885 | WP_193615971.1 | amidohydrolase family protein | - |
| PW274_RS15235 (PW274_15235) | 3226226..3227221 | + | 996 | WP_126312065.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| PW274_RS15240 (PW274_15240) | 3227247..3228878 | - | 1632 | WP_126312066.1 | gamma-glutamyltransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15884.45 Da Isoelectric Point: 8.1045
>T273435 WP_126312062.1 NZ_CP118775:c3223979-3223533 [Delftia tsuruhatensis]
MTRYLLDTNIASHIIKGDIPAVREQLVRVPMHQIAVSAVTQAELMYGVAKRGHPAGLSLRVTGFLARVEVLPWTAQVADA
YGHLRAACEAAGITLASMDMMIAAHALFLQQQAAQAGERSVLVTRDRVFSRIPEPGLAIADWTTGPAG
MTRYLLDTNIASHIIKGDIPAVREQLVRVPMHQIAVSAVTQAELMYGVAKRGHPAGLSLRVTGFLARVEVLPWTAQVADA
YGHLRAACEAAGITLASMDMMIAAHALFLQQQAAQAGERSVLVTRDRVFSRIPEPGLAIADWTTGPAG
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|