Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 2356757..2357799 | Replicon | chromosome |
| Accession | NZ_CP118775 | ||
| Organism | Delftia tsuruhatensis strain ULwDis3 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | PW274_RS11065 | Protein ID | WP_003109777.1 |
| Coordinates | 2357224..2357799 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | PW274_RS11060 | Protein ID | WP_003050245.1 |
| Coordinates | 2356757..2357227 (+) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PW274_RS11025 (PW274_11025) | 2352149..2353567 | - | 1419 | WP_003109776.1 | TIGR03752 family integrating conjugative element protein | - |
| PW274_RS11030 (PW274_11030) | 2353557..2354468 | - | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
| PW274_RS11035 (PW274_11035) | 2354465..2355157 | - | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
| PW274_RS11040 (PW274_11040) | 2355154..2355552 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
| PW274_RS11045 (PW274_11045) | 2355564..2355923 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PW274_RS11050 (PW274_11050) | 2355940..2356173 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
| PW274_RS11055 (PW274_11055) | 2356170..2356553 | - | 384 | WP_003105635.1 | RAQPRD family integrative conjugative element protein | - |
| PW274_RS11060 (PW274_11060) | 2356757..2357227 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PW274_RS11065 (PW274_11065) | 2357224..2357799 | + | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
| PW274_RS11070 (PW274_11070) | 2357817..2358731 | + | 915 | WP_003105629.1 | AAA family ATPase | - |
| PW274_RS11075 (PW274_11075) | 2358728..2359198 | + | 471 | WP_003105626.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| PW274_RS11080 (PW274_11080) | 2359195..2359695 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| PW274_RS11085 (PW274_11085) | 2359695..2360597 | + | 903 | WP_003105624.1 | CBASS oligonucleotide cyclase | - |
| PW274_RS11090 (PW274_11090) | 2360636..2361361 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T273434 WP_003109777.1 NZ_CP118775:2357224-2357799 [Delftia tsuruhatensis]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT273434 WP_003050245.1 NZ_CP118775:2356757-2357227 [Delftia tsuruhatensis]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|