Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4876163..4876779 Replicon chromosome
Accession NZ_CP118774
Organism Citrobacter braakii strain ASE1

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PXN04_RS23120 Protein ID WP_016155182.1
Coordinates 4876163..4876537 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag PXN04_RS23125 Protein ID WP_016155181.1
Coordinates 4876537..4876779 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXN04_RS23105 (PXN04_23105) 4873666..4874568 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
PXN04_RS23110 (PXN04_23110) 4874565..4875200 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
PXN04_RS23115 (PXN04_23115) 4875197..4876126 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
PXN04_RS23120 (PXN04_23120) 4876163..4876537 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
PXN04_RS23125 (PXN04_23125) 4876537..4876779 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
PXN04_RS23130 (PXN04_23130) 4876985..4877914 + 930 WP_169330465.1 alpha/beta hydrolase -
PXN04_RS23135 (PXN04_23135) 4877999..4878310 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
PXN04_RS23140 (PXN04_23140) 4878307..4878759 + 453 WP_141876133.1 helix-turn-helix domain-containing protein -
PXN04_RS23145 (PXN04_23145) 4878777..4879718 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
PXN04_RS23150 (PXN04_23150) 4879763..4880200 - 438 WP_016157874.1 D-aminoacyl-tRNA deacylase -
PXN04_RS23155 (PXN04_23155) 4880197..4881069 - 873 WP_019077938.1 virulence factor BrkB family protein -
PXN04_RS23160 (PXN04_23160) 4881063..4881662 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T273431 WP_016155182.1 NZ_CP118774:c4876537-4876163 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT273431 WP_016155181.1 NZ_CP118774:c4876779-4876537 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References