Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 4262589..4263364 Replicon chromosome
Accession NZ_CP118774
Organism Citrobacter braakii strain ASE1

Toxin (Protein)


Gene name ypjF Uniprot ID A0A1A9F770
Locus tag PXN04_RS20305 Protein ID WP_064324662.1
Coordinates 4262589..4262960 (-) Length 124 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PXN04_RS20310 Protein ID WP_169330389.1
Coordinates 4262999..4263364 (-) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXN04_RS20280 (PXN04_20280) 4259468..4259830 + 363 WP_019078284.1 endoribonuclease SymE -
PXN04_RS20285 (PXN04_20285) 4259888..4260373 - 486 WP_016151545.1 type VI secretion system tube protein TssD -
PXN04_RS20290 (PXN04_20290) 4260392..4260718 - 327 WP_016155588.1 DUF1493 family protein -
PXN04_RS20295 (PXN04_20295) 4260712..4261161 - 450 WP_003830103.1 hypothetical protein -
PXN04_RS20300 (PXN04_20300) 4261420..4262292 + 873 WP_169330388.1 HNH endonuclease -
PXN04_RS20305 (PXN04_20305) 4262589..4262960 - 372 WP_064324662.1 TA system toxin CbtA family protein Toxin
PXN04_RS20310 (PXN04_20310) 4262999..4263364 - 366 WP_169330389.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PXN04_RS20315 (PXN04_20315) 4263390..4263611 - 222 WP_063963757.1 DUF987 family protein -
PXN04_RS20320 (PXN04_20320) 4263608..4264150 - 543 WP_169330390.1 DNA repair protein RadC -
PXN04_RS20325 (PXN04_20325) 4264163..4264606 - 444 WP_001093282.1 antirestriction protein -
PXN04_RS20330 (PXN04_20330) 4264637..4265458 - 822 WP_169330391.1 DUF932 domain-containing protein -
PXN04_RS20335 (PXN04_20335) 4265557..4265787 - 231 WP_063925496.1 DUF905 domain-containing protein -
PXN04_RS20340 (PXN04_20340) 4265859..4266308 - 450 WP_000734140.1 IrmA family protein -
PXN04_RS20345 (PXN04_20345) 4266305..4266757 - 453 WP_000737933.1 hypothetical protein -
PXN04_RS20350 (PXN04_20350) 4266794..4267363 - 570 WP_169330504.1 hypothetical protein -
PXN04_RS20355 (PXN04_20355) 4267363..4268067 - 705 WP_169330392.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4260392..4284395 24003


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(17-116)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13716.66 Da        Isoelectric Point: 6.4803

>T273429 WP_064324662.1 NZ_CP118774:c4262960-4262589 [Citrobacter braakii]
MQTISSHPTRAAQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFSDEATIQEHIDAGISLSDAVNFLVEKYELVRIDCDGC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGQHQEL

Download         Length: 372 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13408.07 Da        Isoelectric Point: 5.4296

>AT273429 WP_169330389.1 NZ_CP118774:c4263364-4262999 [Citrobacter braakii]
MNNHSESGAILENSPCQQWGLKSTITPCFGARLVQEGDRLHFLADRAGFNGAFSDEHALRLDQAFPLILKQLELMLTSGE
LNPRHPHSVTLYHNGLTCEADTLGSCGYVFIAIYPEHTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1A9F770

Antitoxin

Source ID Structure

References