Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3631739..3632359 | Replicon | chromosome |
| Accession | NZ_CP118774 | ||
| Organism | Citrobacter braakii strain ASE1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | PXN04_RS17435 | Protein ID | WP_002892050.1 |
| Coordinates | 3632141..3632359 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A7L6U5G9 |
| Locus tag | PXN04_RS17430 | Protein ID | WP_019076175.1 |
| Coordinates | 3631739..3632113 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXN04_RS17420 (PXN04_17420) | 3626886..3628079 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PXN04_RS17425 (PXN04_17425) | 3628102..3631251 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
| PXN04_RS17430 (PXN04_17430) | 3631739..3632113 | + | 375 | WP_019076175.1 | Hha toxicity modulator TomB | Antitoxin |
| PXN04_RS17435 (PXN04_17435) | 3632141..3632359 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| PXN04_RS17440 (PXN04_17440) | 3632540..3633091 | + | 552 | WP_046276082.1 | maltose O-acetyltransferase | - |
| PXN04_RS17445 (PXN04_17445) | 3633208..3633678 | + | 471 | WP_016152071.1 | YlaC family protein | - |
| PXN04_RS17450 (PXN04_17450) | 3633756..3633896 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| PXN04_RS17455 (PXN04_17455) | 3633898..3634158 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
| PXN04_RS17460 (PXN04_17460) | 3634347..3635900 | + | 1554 | WP_053388979.1 | EAL domain-containing protein | - |
| PXN04_RS17465 (PXN04_17465) | 3635952..3636305 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| PXN04_RS17470 (PXN04_17470) | 3636370..3636999 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273428 WP_002892050.1 NZ_CP118774:3632141-3632359 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14413.20 Da Isoelectric Point: 5.5653
>AT273428 WP_019076175.1 NZ_CP118774:3631739-3632113 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6U5G9 |