Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2331233..2331869 | Replicon | chromosome |
Accession | NZ_CP118774 | ||
Organism | Citrobacter braakii strain ASE1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
Locus tag | PXN04_RS11090 | Protein ID | WP_049259794.1 |
Coordinates | 2331233..2331421 (+) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PXN04_RS11095 | Protein ID | WP_131382557.1 |
Coordinates | 2331453..2331869 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXN04_RS11070 (PXN04_11070) | 2328011..2328241 | - | 231 | WP_016156585.1 | DUF2554 family protein | - |
PXN04_RS11075 (PXN04_11075) | 2328431..2328556 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
PXN04_RS11080 (PXN04_11080) | 2328556..2329566 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
PXN04_RS11085 (PXN04_11085) | 2329566..2330969 | - | 1404 | WP_047417372.1 | cytochrome ubiquinol oxidase subunit I | - |
PXN04_RS11090 (PXN04_11090) | 2331233..2331421 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PXN04_RS11095 (PXN04_11095) | 2331453..2331869 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PXN04_RS11100 (PXN04_11100) | 2331962..2333371 | + | 1410 | WP_019076828.1 | PLP-dependent aminotransferase family protein | - |
PXN04_RS11105 (PXN04_11105) | 2333701..2334846 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
PXN04_RS11110 (PXN04_11110) | 2334863..2335879 | + | 1017 | WP_016153153.1 | ABC transporter ATP-binding protein | - |
PXN04_RS11115 (PXN04_11115) | 2335880..2336824 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T273423 WP_049259794.1 NZ_CP118774:2331233-2331421 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT273423 WP_131382557.1 NZ_CP118774:2331453-2331869 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|