Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 897271..897925 | Replicon | chromosome |
| Accession | NZ_CP118774 | ||
| Organism | Citrobacter braakii strain ASE1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R8WN60 |
| Locus tag | PXN04_RS04425 | Protein ID | WP_016154348.1 |
| Coordinates | 897518..897925 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | R8WMJ6 |
| Locus tag | PXN04_RS04420 | Protein ID | WP_016154349.1 |
| Coordinates | 897271..897537 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXN04_RS04395 (PXN04_04395) | 892484..893917 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
| PXN04_RS04400 (PXN04_04400) | 894038..894766 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| PXN04_RS04405 (PXN04_04405) | 894819..895130 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
| PXN04_RS04410 (PXN04_04410) | 895294..895953 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
| PXN04_RS04415 (PXN04_04415) | 896033..897013 | - | 981 | WP_137352061.1 | tRNA-modifying protein YgfZ | - |
| PXN04_RS04420 (PXN04_04420) | 897271..897537 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
| PXN04_RS04425 (PXN04_04425) | 897518..897925 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
| PXN04_RS04430 (PXN04_04430) | 898026..898547 | - | 522 | WP_169329850.1 | flavodoxin FldB | - |
| PXN04_RS04435 (PXN04_04435) | 898661..899557 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
| PXN04_RS04440 (PXN04_04440) | 899581..900294 | + | 714 | WP_047414418.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PXN04_RS04445 (PXN04_04445) | 900300..902033 | + | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T273422 WP_016154348.1 NZ_CP118774:897518-897925 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|