Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 1646382..1646892 Replicon chromosome
Accession NZ_CP118772
Organism Alcaligenes faecalis strain JF101

Toxin (Protein)


Gene name relB Uniprot ID U1YHF7
Locus tag PWH35_RS07610 Protein ID WP_009459444.1
Coordinates 1646382..1646645 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID U1Y0D2
Locus tag PWH35_RS07615 Protein ID WP_009459443.1
Coordinates 1646638..1646892 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWH35_RS07565 (PWH35_07565) 1641606..1641950 - 345 WP_009459464.1 SMR family transporter -
PWH35_RS07570 (PWH35_07570) 1641957..1642475 - 519 WP_026484694.1 DedA family protein -
PWH35_RS07575 (PWH35_07575) 1642513..1642983 - 471 WP_250757004.1 GNAT family N-acetyltransferase -
PWH35_RS07580 (PWH35_07580) 1642980..1643381 - 402 WP_009459461.1 YchJ family metal-binding protein -
PWH35_RS07585 (PWH35_07585) 1643718..1644476 - 759 WP_009459460.1 M48 family metallopeptidase -
PWH35_RS07590 (PWH35_07590) 1644614..1644850 + 237 WP_250757005.1 hypothetical protein -
PWH35_RS07595 (PWH35_07595) 1644873..1645220 - 348 Protein_1481 MFS transporter -
PWH35_RS07600 (PWH35_07600) 1645239..1645364 - 126 WP_009459451.1 major facilitator superfamily transporter -
PWH35_RS07610 (PWH35_07610) 1646382..1646645 - 264 WP_009459444.1 Txe/YoeB family addiction module toxin Toxin
PWH35_RS07615 (PWH35_07615) 1646638..1646892 - 255 WP_009459443.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PWH35_RS07620 (PWH35_07620) 1647082..1647348 + 267 WP_035275328.1 hypothetical protein -
PWH35_RS07625 (PWH35_07625) 1647385..1648074 - 690 WP_088453217.1 S24 family peptidase -
PWH35_RS07630 (PWH35_07630) 1648028..1648549 - 522 WP_250757007.1 hypothetical protein -
PWH35_RS07635 (PWH35_07635) 1648611..1649396 + 786 WP_250757008.1 hypothetical protein -
PWH35_RS07640 (PWH35_07640) 1649380..1650087 + 708 WP_009459907.1 replication protein P -
PWH35_RS07645 (PWH35_07645) 1650095..1650418 + 324 WP_250757009.1 hypothetical protein -
PWH35_RS07650 (PWH35_07650) 1650432..1650812 + 381 WP_021446766.1 hypothetical protein -
PWH35_RS07655 (PWH35_07655) 1650809..1651057 + 249 WP_009459904.1 hypothetical protein -
PWH35_RS07660 (PWH35_07660) 1651232..1651651 + 420 WP_009459902.1 phage tail terminator-like protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10382.88 Da        Isoelectric Point: 9.0343

>T273421 WP_009459444.1 NZ_CP118772:c1646645-1646382 [Alcaligenes faecalis]
MTDRLLCWTDAAWIDYVYWQGQDRKTLKRINRLIEEVRRAPFDGIGKPEALKENLSGFWSRRIDDTNRLVYAVDKASITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9416.59 Da        Isoelectric Point: 4.7778

>AT273421 WP_009459443.1 NZ_CP118772:c1646892-1646638 [Alcaligenes faecalis]
MKIISFSEARNSLKAVLDSVVDDASTTIITRRDAEDAVVMSLDYYNSLMETVHLLRSPANAEHLSRSIEQYRAGKAMPRE
LSDD

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U1YHF7

Antitoxin

Source ID Structure
AlphaFold DB U1Y0D2

References