Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 70472..71609 | Replicon | plasmid pW5-2 |
| Accession | NZ_CP118757 | ||
| Organism | Enterococcus faecalis strain W5 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | PWA41_RS14700 | Protein ID | WP_002332783.1 |
| Coordinates | 70472..71335 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | PWA41_RS14705 | Protein ID | WP_002326825.1 |
| Coordinates | 71337..71609 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA41_RS14660 (PWA41_14655) | 66318..66434 | - | 117 | Protein_81 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| PWA41_RS14665 (PWA41_14660) | 66604..67341 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| PWA41_RS14670 (PWA41_14665) | 67466..67549 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| PWA41_RS14675 (PWA41_14670) | 67672..67839 | - | 168 | Protein_84 | peptide-binding protein | - |
| PWA41_RS14680 (PWA41_14675) | 67973..68122 | - | 150 | Protein_85 | topoisomerase | - |
| PWA41_RS14685 (PWA41_14680) | 68198..68878 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
| PWA41_RS14690 (PWA41_14685) | 68912..69418 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| PWA41_RS14695 (PWA41_14690) | 69715..70032 | - | 318 | WP_002326830.1 | hypothetical protein | - |
| PWA41_RS14700 (PWA41_14695) | 70472..71335 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| PWA41_RS14705 (PWA41_14700) | 71337..71609 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| PWA41_RS14710 (PWA41_14705) | 71627..71842 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| PWA41_RS14715 (PWA41_14710) | 71934..72830 | - | 897 | WP_002326827.1 | ParA family protein | - |
| PWA41_RS14720 (PWA41_14715) | 72933..73193 | - | 261 | Protein_93 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| PWA41_RS14725 (PWA41_14720) | 73363..74100 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| PWA41_RS14730 (PWA41_14725) | 74225..74308 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| PWA41_RS14735 (PWA41_14730) | 74740..75111 | - | 372 | WP_002358205.1 | hypothetical protein | - |
| PWA41_RS14740 (PWA41_14735) | 75104..75949 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(L) / tet(M) / fexA / optrA / erm(A) / erm(B) / aph(3')-III / ant(6)-Ia / dfrG | - | 1..76420 | 76420 | |
| - | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / dfrG | - | 62478..74100 | 11622 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T273419 WP_002332783.1 NZ_CP118757:c71335-70472 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |