273418

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 55871..56442 Replicon plasmid pW5-2
Accession NZ_CP118757
Organism Enterococcus faecalis strain W5

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PWA41_RS14565 Protein ID WP_002362432.1
Coordinates 55871..56212 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PWA41_RS14570 Protein ID WP_002362431.1
Coordinates 56212..56442 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWA41_RS14550 (PWA41_14545) 52608..53210 - 603 WP_002362434.1 Fic family protein -
PWA41_RS14555 (PWA41_14550) 53454..54632 - 1179 WP_000997695.1 IS256-like element ISEf1 family transposase -
PWA41_RS14560 (PWA41_14555) 54821..55759 - 939 WP_002362433.1 hypothetical protein -
PWA41_RS14565 (PWA41_14560) 55871..56212 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PWA41_RS14570 (PWA41_14565) 56212..56442 - 231 WP_002362431.1 hypothetical protein Antitoxin
PWA41_RS14575 (PWA41_14570) 56646..57266 + 621 WP_002367784.1 recombinase family protein -
PWA41_RS14580 (PWA41_14575) 57256..57570 + 315 WP_002367785.1 hypothetical protein -
PWA41_RS14585 (PWA41_14580) 57564..57770 + 207 WP_002367786.1 hypothetical protein -
PWA41_RS14590 (PWA41_14585) 57930..58124 + 195 WP_002367787.1 hypothetical protein -
PWA41_RS14595 (PWA41_14590) 58136..58327 + 192 WP_002367788.1 hypothetical protein -
PWA41_RS14600 (PWA41_14595) 58497..58712 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
PWA41_RS14605 (PWA41_14600) 58713..59054 + 342 WP_002367792.1 bacteriocin immunity protein -
PWA41_RS14610 (PWA41_14605) 59470..59988 + 519 WP_002367793.1 hypothetical protein -
PWA41_RS14615 (PWA41_14610) 59936..60151 + 216 WP_002415356.1 hypothetical protein -
PWA41_RS14620 (PWA41_14615) 60243..60329 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
PWA41_RS14625 (PWA41_14620) 60586..60882 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / fexA / optrA / erm(A) / erm(B) / aph(3')-III / ant(6)-Ia / dfrG - 1..76420 76420


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T273418 WP_002362432.1 NZ_CP118757:c56212-55871 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT273418 WP_002362431.1 NZ_CP118757:c56442-56212 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References