Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 5226..5797 Replicon plasmid pW5-1
Accession NZ_CP118756
Organism Enterococcus faecalis strain W5

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PWA41_RS13845 Protein ID WP_002362432.1
Coordinates 5226..5567 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PWA41_RS13850 Protein ID WP_002362431.1
Coordinates 5567..5797 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWA41_RS13830 (2763) 2763..3068 - 306 Protein_2 TraC-F-type conjugal transfer protein -
PWA41_RS13835 (3124) 3124..3804 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
PWA41_RS13840 (4176) 4176..5114 - 939 WP_265624679.1 hypothetical protein -
PWA41_RS13845 (5226) 5226..5567 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PWA41_RS13850 (5567) 5567..5797 - 231 WP_002362431.1 hypothetical protein Antitoxin
PWA41_RS13855 (6001) 6001..6621 + 621 WP_231433215.1 recombinase family protein -
PWA41_RS13860 (6638) 6638..6922 + 285 WP_064686968.1 hypothetical protein -
PWA41_RS13865 (6919) 6919..7140 + 222 WP_080474121.1 hypothetical protein -
PWA41_RS13870 (7624) 7624..7824 + 201 WP_064686967.1 hypothetical protein -
PWA41_RS13875 (8028) 8028..9824 + 1797 WP_064686966.1 AIPR family protein -
PWA41_RS13880 (10214) 10214..10342 - 129 WP_258076850.1 hypothetical protein -
PWA41_RS13885 (10435) 10435..10686 + 252 WP_064686964.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - prgB/asc10 / EF0485 1..77691 77691
- flank IS/Tn - - 3124..3810 686


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T273417 WP_002362432.1 NZ_CP118756:c5567-5226 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT273417 WP_002362431.1 NZ_CP118756:c5797-5567 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References