Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2755533..2756104 | Replicon | chromosome |
| Accession | NZ_CP118755 | ||
| Organism | Enterococcus faecalis strain W5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PWA41_RS13345 | Protein ID | WP_002354774.1 |
| Coordinates | 2755533..2755874 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | PWA41_RS13350 | Protein ID | WP_002354773.1 |
| Coordinates | 2755874..2756104 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA41_RS13340 (2751548) | 2751548..2755162 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| PWA41_RS13345 (2755533) | 2755533..2755874 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PWA41_RS13350 (2755874) | 2755874..2756104 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| PWA41_RS13355 (2756518) | 2756518..2756733 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PWA41_RS13360 (2756872) | 2756872..2757864 | + | 993 | WP_016632734.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PWA41_RS13365 (2757931) | 2757931..2758563 | - | 633 | WP_002358972.1 | RloB family protein | - |
| PWA41_RS13370 (2758572) | 2758572..2759867 | - | 1296 | WP_275016500.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T273411 WP_002354774.1 NZ_CP118755:c2755874-2755533 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|