Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2541118..2541683 | Replicon | chromosome |
Accession | NZ_CP118745 | ||
Organism | Lactiplantibacillus paraplantarum strain FL-8 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | F9URY0 |
Locus tag | PWO93_RS12050 | Protein ID | WP_011101950.1 |
Coordinates | 2541118..2541465 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | F9URY1 |
Locus tag | PWO93_RS12055 | Protein ID | WP_011101951.1 |
Coordinates | 2541465..2541683 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO93_RS12025 (PWO93_12025) | 2537201..2537839 | - | 639 | WP_275090993.1 | NAD(P)H-binding protein | - |
PWO93_RS12030 (PWO93_12030) | 2538191..2538634 | - | 444 | WP_275090994.1 | universal stress protein | - |
PWO93_RS12035 (PWO93_12035) | 2538706..2539275 | - | 570 | WP_275090995.1 | sugar O-acetyltransferase | - |
PWO93_RS12040 (PWO93_12040) | 2539372..2540055 | + | 684 | WP_275090996.1 | YjjG family noncanonical pyrimidine nucleotidase | - |
PWO93_RS12045 (PWO93_12045) | 2540181..2540696 | - | 516 | WP_275090997.1 | hypothetical protein | - |
PWO93_RS12050 (PWO93_12050) | 2541118..2541465 | - | 348 | WP_011101950.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PWO93_RS12055 (PWO93_12055) | 2541465..2541683 | - | 219 | WP_011101951.1 | hypothetical protein | Antitoxin |
PWO93_RS12060 (PWO93_12060) | 2542424..2542939 | - | 516 | WP_275090998.1 | hypothetical protein | - |
PWO93_RS12065 (PWO93_12065) | 2543153..2543431 | - | 279 | WP_131510272.1 | hypothetical protein | - |
PWO93_RS12070 (PWO93_12070) | 2543932..2544525 | - | 594 | WP_275090999.1 | NAD(P)-binding domain-containing protein | - |
PWO93_RS12075 (PWO93_12075) | 2544674..2545846 | - | 1173 | WP_275091000.1 | MalY/PatB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13274.06 Da Isoelectric Point: 9.5016
>T273399 WP_011101950.1 NZ_CP118745:c2541465-2541118 [Lactiplantibacillus paraplantarum]
MTYLPKQKDIIWIDFDPQRGREIKKRRPAVVLSSNLYTQNTGFVIVSPITSTMRDLPGYFSLNGYNTHGQIAAAQIYSFD
ATPRAGRSITYIETMRSADFYHVAQTVYYNFDFPF
MTYLPKQKDIIWIDFDPQRGREIKKRRPAVVLSSNLYTQNTGFVIVSPITSTMRDLPGYFSLNGYNTHGQIAAAQIYSFD
ATPRAGRSITYIETMRSADFYHVAQTVYYNFDFPF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|