Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 579759..580395 | Replicon | chromosome |
Accession | NZ_CP118744 | ||
Organism | Bacillus paralicheniformis strain RP01 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | M5P3Q9 |
Locus tag | PWG69_RS02905 | Protein ID | WP_003179128.1 |
Coordinates | 580045..580395 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | M5PDU2 |
Locus tag | PWG69_RS02900 | Protein ID | WP_006638778.1 |
Coordinates | 579759..580040 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWG69_RS02880 (PWG69_02880) | 574870..576354 | + | 1485 | WP_023857868.1 | PH domain-containing protein | - |
PWG69_RS02885 (PWG69_02885) | 576351..576950 | - | 600 | WP_023857867.1 | rhomboid family intramembrane serine protease | - |
PWG69_RS02890 (PWG69_02890) | 577294..578253 | + | 960 | WP_164468292.1 | outer membrane lipoprotein carrier protein LolA | - |
PWG69_RS02895 (PWG69_02895) | 578478..579647 | + | 1170 | WP_023857864.1 | alanine racemase | - |
PWG69_RS02900 (PWG69_02900) | 579759..580040 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
PWG69_RS02905 (PWG69_02905) | 580045..580395 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PWG69_RS02910 (PWG69_02910) | 580513..581340 | + | 828 | WP_025810067.1 | RsbT co-antagonist protein RsbRA | - |
PWG69_RS02915 (PWG69_02915) | 581344..581709 | + | 366 | WP_020450259.1 | STAS domain-containing protein | - |
PWG69_RS02920 (PWG69_02920) | 581712..582113 | + | 402 | WP_020450260.1 | anti-sigma regulatory factor | - |
PWG69_RS02925 (PWG69_02925) | 582124..583131 | + | 1008 | WP_020450261.1 | PP2C family protein-serine/threonine phosphatase | - |
PWG69_RS02930 (PWG69_02930) | 583190..583516 | + | 327 | WP_020450262.1 | anti-sigma factor antagonist | - |
PWG69_RS02935 (PWG69_02935) | 583516..583998 | + | 483 | WP_020450263.1 | anti-sigma B factor RsbW | - |
PWG69_RS02940 (PWG69_02940) | 583964..584755 | + | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
PWG69_RS02945 (PWG69_02945) | 584752..585351 | + | 600 | WP_020450265.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T273397 WP_003179128.1 NZ_CP118744:580045-580395 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6I7FHI4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M5PDU2 |