Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 13257..13792 Replicon plasmid pAHRB3
Accession NZ_CP118724
Organism Serratia marcescens strain AHRB3

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWO23_RS23815 Protein ID WP_110147647.1
Coordinates 13257..13544 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PWO23_RS23820 Protein ID WP_110147646.1
Coordinates 13541..13792 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWO23_RS23770 (PWO23_23780) 8516..8863 - 348 WP_110147654.1 hypothetical protein -
PWO23_RS23775 (PWO23_23785) 8899..9315 - 417 WP_110147653.1 protein TraE -
PWO23_RS23780 (PWO23_23790) 9375..9797 - 423 WP_274985499.1 hypothetical protein -
PWO23_RS23785 (PWO23_23795) 10302..10529 - 228 WP_110147651.1 helix-turn-helix domain-containing protein -
PWO23_RS23790 (PWO23_23800) 10602..11132 - 531 WP_110147650.1 hypothetical protein -
PWO23_RS23795 (PWO23_23805) 11142..11381 - 240 WP_110147649.1 hypothetical protein -
PWO23_RS23800 (PWO23_23810) 11603..11956 - 354 WP_148666840.1 hypothetical protein -
PWO23_RS23805 (PWO23_23815) 12433..12906 - 474 WP_148666839.1 hypothetical protein -
PWO23_RS23810 (PWO23_23820) 12927..13205 - 279 WP_126502313.1 hypothetical protein -
PWO23_RS23815 (PWO23_23825) 13257..13544 - 288 WP_110147647.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWO23_RS23820 (PWO23_23830) 13541..13792 - 252 WP_110147646.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWO23_RS23825 (PWO23_23835) 13888..14334 - 447 WP_110147645.1 dehydrogenase -
PWO23_RS23830 (PWO23_23840) 15001..15219 - 219 WP_110147644.1 hypothetical protein -
PWO23_RS23835 (PWO23_23845) 15216..15599 - 384 WP_148666837.1 hypothetical protein -
PWO23_RS23840 (PWO23_23850) 15658..16395 - 738 WP_110147643.1 plasmid SOS inhibition protein A -
PWO23_RS23845 (PWO23_23855) 16392..16856 - 465 WP_110147642.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..72947 72947


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10919.00 Da        Isoelectric Point: 10.3243

>T273396 WP_110147647.1 NZ_CP118724:c13544-13257 [Serratia marcescens]
MTYKVKFRESALKEWGKLDKSLQQQFAKKLKKCCENPHIPSAKLRGMPGCYKIKLRASGFRLVYEVIDDCLIIAVVAVGK
RERGDVYQLASERLK

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9202.41 Da        Isoelectric Point: 3.9015

>AT273396 WP_110147646.1 NZ_CP118724:c13792-13541 [Serratia marcescens]
MPNIILSDTSASISELKKNPMETVGAGDGFPVAILNRNQPAFYCVPAALYEQMLDALDDQELVRLVNERRSEALVDFDLD
QFA

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References