Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4049694..4050363 | Replicon | chromosome |
Accession | NZ_CP118723 | ||
Organism | Serratia marcescens strain AHRB3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PWO23_RS19400 | Protein ID | WP_016929976.1 |
Coordinates | 4049694..4050116 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
Locus tag | PWO23_RS19405 | Protein ID | WP_004931679.1 |
Coordinates | 4050097..4050363 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO23_RS19380 (PWO23_19390) | 4045580..4046098 | + | 519 | WP_004931683.1 | flavodoxin FldB | - |
PWO23_RS19385 (PWO23_19395) | 4046136..4047500 | - | 1365 | WP_016929973.1 | cell envelope integrity protein CreD | - |
PWO23_RS19390 (PWO23_19400) | 4047581..4048999 | - | 1419 | WP_016929974.1 | two-component system sensor histidine kinase CreC | - |
PWO23_RS19395 (PWO23_19405) | 4048996..4049694 | - | 699 | WP_016929975.1 | two-component system response regulator CreB | - |
PWO23_RS19400 (PWO23_19410) | 4049694..4050116 | - | 423 | WP_016929976.1 | protein YgfX | Toxin |
PWO23_RS19405 (PWO23_19415) | 4050097..4050363 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
PWO23_RS19410 (PWO23_19420) | 4050684..4051676 | + | 993 | WP_016929977.1 | tRNA-modifying protein YgfZ | - |
PWO23_RS19415 (PWO23_19425) | 4051715..4052212 | - | 498 | WP_079452406.1 | DUF2165 domain-containing protein | - |
PWO23_RS19420 (PWO23_19430) | 4052363..4053037 | - | 675 | WP_028127690.1 | hemolysin III family protein | - |
PWO23_RS19425 (PWO23_19435) | 4053221..4053829 | + | 609 | WP_028127691.1 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16501.62 Da Isoelectric Point: 11.2159
>T273393 WP_016929976.1 NZ_CP118723:c4050116-4049694 [Serratia marcescens]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLHPPAGNGEEP
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLHPPAGNGEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|