Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1361497..1362064 Replicon chromosome
Accession NZ_CP118723
Organism Serratia marcescens strain AHRB3

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PWO23_RS06490 Protein ID WP_234213958.1
Coordinates 1361497..1361802 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A8B4G8D1
Locus tag PWO23_RS06495 Protein ID WP_016928576.1
Coordinates 1361804..1362064 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWO23_RS06455 (PWO23_06460) 1357145..1358221 + 1077 WP_025302022.1 urea ABC transporter permease subunit UrtC -
PWO23_RS06460 (PWO23_06465) 1358218..1359024 + 807 WP_015377102.1 urea ABC transporter ATP-binding protein UrtD -
PWO23_RS06465 (PWO23_06470) 1359037..1359735 + 699 WP_079449519.1 urea ABC transporter ATP-binding subunit UrtE -
PWO23_RS06470 (PWO23_06475) 1359743..1360042 - 300 WP_042783942.1 type II toxin-antitoxin system RelE/ParE family toxin -
PWO23_RS06475 (PWO23_06480) 1360027..1360290 - 264 WP_004939442.1 type II toxin-antitoxin system ParD family antitoxin -
PWO23_RS06480 (PWO23_06485) 1360425..1360937 + 513 WP_016928579.1 DUF2165 family protein -
PWO23_RS06485 (PWO23_06490) 1360960..1361472 - 513 WP_016928578.1 GNAT family N-acetyltransferase -
PWO23_RS06490 (PWO23_06495) 1361497..1361802 - 306 WP_234213958.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWO23_RS06495 (PWO23_06500) 1361804..1362064 - 261 WP_016928576.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWO23_RS06500 (PWO23_06505) 1362133..1363368 - 1236 WP_049208920.1 FAD-dependent oxidoreductase -
PWO23_RS06505 (PWO23_06510) 1363445..1364014 - 570 WP_016928574.1 DUF4865 family protein -
PWO23_RS06510 (PWO23_06515) 1364120..1364989 + 870 WP_016928573.1 LysR substrate-binding domain-containing protein -
PWO23_RS06515 (PWO23_06520) 1364986..1365831 - 846 WP_033640962.1 3-mercaptopyruvate sulfurtransferase -
PWO23_RS06520 (PWO23_06525) 1365938..1366363 + 426 WP_049299531.1 NUDIX hydrolase -
PWO23_RS06525 (PWO23_06530) 1366371..1367036 - 666 WP_049299499.1 epimerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-65)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11965.69 Da        Isoelectric Point: 8.6471

>T273386 WP_234213958.1 NZ_CP118723:c1361802-1361497 [Serratia marcescens]
MPAFRLTPQAQQDLLAIRHFTIEHWGQAQSRRYLEQLREVMHHLADMPEAGKAHFHDLGEEIHSFPYASHRIYYRNRPAG
ITVLTILHQAMVPHRHLEQRL

Download         Length: 306 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9442.59 Da        Isoelectric Point: 4.1964

>AT273386 WP_016928576.1 NZ_CP118723:c1362064-1361804 [Serratia marcescens]
MYALTANEAKTQFGDLLLKAQREPVQINRNGKPVAVVMSVEDYQALEDLKLSALQQKIAQATAEEDAGKAVDGDAFFNRL
LTDETD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A8B4G8D1

References