Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1015206..1015827 Replicon chromosome
Accession NZ_CP118723
Organism Serratia marcescens strain AHRB3

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag PWO23_RS04765 Protein ID WP_004940313.1
Coordinates 1015206..1015409 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag PWO23_RS04770 Protein ID WP_004940312.1
Coordinates 1015459..1015827 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWO23_RS04735 (PWO23_04740) 1010907..1011245 + 339 WP_004940327.1 P-II family nitrogen regulator -
PWO23_RS04740 (PWO23_04745) 1011281..1012567 + 1287 WP_004940322.1 ammonium transporter AmtB -
PWO23_RS04745 (PWO23_04750) 1012658..1013521 - 864 WP_016928847.1 acyl-CoA thioesterase II -
PWO23_RS04750 (PWO23_04755) 1013752..1014243 + 492 WP_016928846.1 YbaY family lipoprotein -
PWO23_RS04755 (PWO23_04760) 1014308..1014622 - 315 WP_004940317.1 MGMT family protein -
PWO23_RS04765 (PWO23_04770) 1015206..1015409 - 204 WP_004940313.1 HHA domain-containing protein Toxin
PWO23_RS04770 (PWO23_04775) 1015459..1015827 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
PWO23_RS04775 (PWO23_04780) 1015986..1016339 - 354 WP_016928845.1 hypothetical protein -
PWO23_RS04780 (PWO23_04785) 1016744..1017457 + 714 WP_197783530.1 ABC transporter ATP-binding protein -
PWO23_RS04785 (PWO23_04790) 1017454..1018311 + 858 WP_004940309.1 metal ABC transporter permease -
PWO23_RS04790 (PWO23_04795) 1018337..1019215 + 879 WP_274985245.1 metal ABC transporter substrate-binding protein -
PWO23_RS04795 (PWO23_04800) 1019323..1019463 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
PWO23_RS04800 (PWO23_04805) 1019476..1019730 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T273385 WP_004940313.1 NZ_CP118723:c1015409-1015206 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT273385 WP_004940312.1 NZ_CP118723:c1015827-1015459 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References