Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1015206..1015827 | Replicon | chromosome |
Accession | NZ_CP118723 | ||
Organism | Serratia marcescens strain AHRB3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A8B4G7F9 |
Locus tag | PWO23_RS04765 | Protein ID | WP_004940313.1 |
Coordinates | 1015206..1015409 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
Locus tag | PWO23_RS04770 | Protein ID | WP_004940312.1 |
Coordinates | 1015459..1015827 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO23_RS04735 (PWO23_04740) | 1010907..1011245 | + | 339 | WP_004940327.1 | P-II family nitrogen regulator | - |
PWO23_RS04740 (PWO23_04745) | 1011281..1012567 | + | 1287 | WP_004940322.1 | ammonium transporter AmtB | - |
PWO23_RS04745 (PWO23_04750) | 1012658..1013521 | - | 864 | WP_016928847.1 | acyl-CoA thioesterase II | - |
PWO23_RS04750 (PWO23_04755) | 1013752..1014243 | + | 492 | WP_016928846.1 | YbaY family lipoprotein | - |
PWO23_RS04755 (PWO23_04760) | 1014308..1014622 | - | 315 | WP_004940317.1 | MGMT family protein | - |
PWO23_RS04765 (PWO23_04770) | 1015206..1015409 | - | 204 | WP_004940313.1 | HHA domain-containing protein | Toxin |
PWO23_RS04770 (PWO23_04775) | 1015459..1015827 | - | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
PWO23_RS04775 (PWO23_04780) | 1015986..1016339 | - | 354 | WP_016928845.1 | hypothetical protein | - |
PWO23_RS04780 (PWO23_04785) | 1016744..1017457 | + | 714 | WP_197783530.1 | ABC transporter ATP-binding protein | - |
PWO23_RS04785 (PWO23_04790) | 1017454..1018311 | + | 858 | WP_004940309.1 | metal ABC transporter permease | - |
PWO23_RS04790 (PWO23_04795) | 1018337..1019215 | + | 879 | WP_274985245.1 | metal ABC transporter substrate-binding protein | - |
PWO23_RS04795 (PWO23_04800) | 1019323..1019463 | - | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
PWO23_RS04800 (PWO23_04805) | 1019476..1019730 | - | 255 | WP_004940303.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8107.37 Da Isoelectric Point: 6.9756
>T273385 WP_004940313.1 NZ_CP118723:c1015409-1015206 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT273385 WP_004940312.1 NZ_CP118723:c1015827-1015459 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4G7F9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X2G5J9 |