Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 197348..197984 | Replicon | chromosome |
| Accession | NZ_CP118718 | ||
| Organism | Priestia aryabhattai strain G5MAi6 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D5DWT4 |
| Locus tag | PWO00_RS01120 | Protein ID | WP_013055004.1 |
| Coordinates | 197634..197984 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | D5DWT3 |
| Locus tag | PWO00_RS01115 | Protein ID | WP_013055003.1 |
| Coordinates | 197348..197629 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWO00_RS01090 (PWO00_01090) | 192714..193685 | + | 972 | WP_074683554.1 | UV DNA damage repair endonuclease UvsE | - |
| PWO00_RS01095 (PWO00_01095) | 193694..194296 | - | 603 | WP_275036680.1 | rhomboid family intramembrane serine protease | - |
| PWO00_RS01100 (PWO00_01100) | 194361..194726 | + | 366 | WP_028411881.1 | holo-ACP synthase | - |
| PWO00_RS01105 (PWO00_01105) | 194785..195843 | + | 1059 | WP_221816542.1 | outer membrane lipoprotein carrier protein LolA | - |
| PWO00_RS01110 (PWO00_01110) | 195957..197147 | + | 1191 | WP_275036681.1 | alanine racemase | - |
| PWO00_RS01115 (PWO00_01115) | 197348..197629 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
| PWO00_RS01120 (PWO00_01120) | 197634..197984 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PWO00_RS01125 (PWO00_01125) | 198142..198978 | + | 837 | WP_221816540.1 | RsbT co-antagonist protein RsbRA | - |
| PWO00_RS01130 (PWO00_01130) | 198981..199337 | + | 357 | WP_013055006.1 | STAS domain-containing protein | - |
| PWO00_RS01135 (PWO00_01135) | 199341..199742 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
| PWO00_RS01140 (PWO00_01140) | 199756..200766 | + | 1011 | WP_045295109.1 | PP2C family protein-serine/threonine phosphatase | - |
| PWO00_RS01145 (PWO00_01145) | 200826..201158 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
| PWO00_RS01150 (PWO00_01150) | 201155..201640 | + | 486 | WP_025753516.1 | anti-sigma B factor RsbW | - |
| PWO00_RS01155 (PWO00_01155) | 201606..202400 | + | 795 | WP_275036682.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T273384 WP_013055004.1 NZ_CP118718:197634-197984 [Priestia aryabhattai]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|