Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4077786..4078444 | Replicon | chromosome |
Accession | NZ_CP118713 | ||
Organism | Rhizobium sp. BJ04 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PO860_RS19935 | Protein ID | WP_273884406.1 |
Coordinates | 4078028..4078444 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PO860_RS19930 | Protein ID | WP_183608480.1 |
Coordinates | 4077786..4078028 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO860_RS19905 (PO860_19905) | 4073162..4074145 | - | 984 | WP_273884409.1 | UDP-glucose 4-epimerase GalE | - |
PO860_RS19910 (PO860_19910) | 4074420..4075064 | + | 645 | WP_272783520.1 | ThuA domain-containing protein | - |
PO860_RS19915 (PO860_19915) | 4075123..4075692 | + | 570 | WP_273884408.1 | GNAT family N-acetyltransferase | - |
PO860_RS19920 (PO860_19920) | 4075727..4075978 | - | 252 | WP_273881337.1 | DUF2934 domain-containing protein | - |
PO860_RS19925 (PO860_19925) | 4076180..4077616 | + | 1437 | WP_273884407.1 | hypothetical protein | - |
PO860_RS19930 (PO860_19930) | 4077786..4078028 | + | 243 | WP_183608480.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PO860_RS19935 (PO860_19935) | 4078028..4078444 | + | 417 | WP_273884406.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PO860_RS19945 (PO860_19945) | 4078919..4079236 | + | 318 | WP_003543907.1 | 50S ribosomal protein L21 | - |
PO860_RS19950 (PO860_19950) | 4079271..4079540 | + | 270 | WP_003567620.1 | 50S ribosomal protein L27 | - |
PO860_RS19955 (PO860_19955) | 4079666..4080322 | + | 657 | WP_183608478.1 | GNAT family protein | - |
PO860_RS19960 (PO860_19960) | 4080319..4080906 | + | 588 | WP_272783516.1 | GNAT family N-acetyltransferase | - |
PO860_RS19965 (PO860_19965) | 4080944..4081810 | - | 867 | WP_272783515.1 | endonuclease/exonuclease/phosphatase family protein | - |
PO860_RS19970 (PO860_19970) | 4081895..4082977 | + | 1083 | WP_273884404.1 | GTPase ObgE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14940.95 Da Isoelectric Point: 6.2307
>T273382 WP_273884406.1 NZ_CP118713:4078028-4078444 [Rhizobium sp. BJ04]
MIHLDTNVAVALLNGRPRQVRERFDEARNAGTPLGLSIIVYHELMYGAAASERRHANEEKIALFIASGGISLIDFNEGDA
QEAADIRAYLRRQGTPIGPYDVLIAAQARRAGTVLVTANTGEFVRVPGLQVLDWAAAS
MIHLDTNVAVALLNGRPRQVRERFDEARNAGTPLGLSIIVYHELMYGAAASERRHANEEKIALFIASGGISLIDFNEGDA
QEAADIRAYLRRQGTPIGPYDVLIAAQARRAGTVLVTANTGEFVRVPGLQVLDWAAAS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|