Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4117492..4118150 | Replicon | chromosome |
| Accession | NZ_CP118687 | ||
| Organism | Rhizobium sp. MJ22 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PO862_RS20315 | Protein ID | WP_273884406.1 |
| Coordinates | 4117734..4118150 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PO862_RS20310 | Protein ID | WP_183608480.1 |
| Coordinates | 4117492..4117734 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO862_RS20285 (PO862_20285) | 4112868..4113851 | - | 984 | WP_275033022.1 | UDP-glucose 4-epimerase GalE | - |
| PO862_RS20290 (PO862_20290) | 4114126..4114770 | + | 645 | WP_272783520.1 | ThuA domain-containing protein | - |
| PO862_RS20295 (PO862_20295) | 4114829..4115398 | + | 570 | WP_275033025.1 | GNAT family N-acetyltransferase | - |
| PO862_RS20300 (PO862_20300) | 4115433..4115684 | - | 252 | WP_273881337.1 | DUF2934 domain-containing protein | - |
| PO862_RS20305 (PO862_20305) | 4115886..4117322 | + | 1437 | WP_273884407.1 | hypothetical protein | - |
| PO862_RS20310 (PO862_20310) | 4117492..4117734 | + | 243 | WP_183608480.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PO862_RS20315 (PO862_20315) | 4117734..4118150 | + | 417 | WP_273884406.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PO862_RS20325 (PO862_20325) | 4118625..4118942 | + | 318 | WP_003543907.1 | 50S ribosomal protein L21 | - |
| PO862_RS20330 (PO862_20330) | 4118977..4119246 | + | 270 | WP_003567620.1 | 50S ribosomal protein L27 | - |
| PO862_RS20335 (PO862_20335) | 4119372..4120028 | + | 657 | WP_183608478.1 | GNAT family protein | - |
| PO862_RS20340 (PO862_20340) | 4120025..4120612 | + | 588 | WP_272783516.1 | GNAT family N-acetyltransferase | - |
| PO862_RS20345 (PO862_20345) | 4120650..4121516 | - | 867 | WP_272783515.1 | endonuclease/exonuclease/phosphatase family protein | - |
| PO862_RS20350 (PO862_20350) | 4121601..4122683 | + | 1083 | WP_273884404.1 | GTPase ObgE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14940.95 Da Isoelectric Point: 6.2307
>T273375 WP_273884406.1 NZ_CP118687:4117734-4118150 [Rhizobium sp. MJ22]
MIHLDTNVAVALLNGRPRQVRERFDEARNAGTPLGLSIIVYHELMYGAAASERRHANEEKIALFIASGGISLIDFNEGDA
QEAADIRAYLRRQGTPIGPYDVLIAAQARRAGTVLVTANTGEFVRVPGLQVLDWAAAS
MIHLDTNVAVALLNGRPRQVRERFDEARNAGTPLGLSIIVYHELMYGAAASERRHANEEKIALFIASGGISLIDFNEGDA
QEAADIRAYLRRQGTPIGPYDVLIAAQARRAGTVLVTANTGEFVRVPGLQVLDWAAAS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|