Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 3957968..3958500 | Replicon | chromosome |
Accession | NZ_CP118687 | ||
Organism | Rhizobium sp. MJ22 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PO862_RS19585 | Protein ID | WP_273884469.1 |
Coordinates | 3957968..3958258 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | PO862_RS19590 | Protein ID | WP_273881409.1 |
Coordinates | 3958255..3958500 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO862_RS19565 (PO862_19565) | 3953554..3954222 | - | 669 | WP_273884473.1 | NUDIX hydrolase | - |
PO862_RS19570 (PO862_19570) | 3954393..3955295 | + | 903 | WP_273884472.1 | hypothetical protein | - |
PO862_RS19575 (PO862_19575) | 3955353..3956582 | + | 1230 | WP_275032846.1 | adenylosuccinate synthetase | - |
PO862_RS19580 (PO862_19580) | 3956638..3957861 | - | 1224 | WP_183608611.1 | argininosuccinate synthase | - |
PO862_RS19585 (PO862_19585) | 3957968..3958258 | - | 291 | WP_273884469.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PO862_RS19590 (PO862_19590) | 3958255..3958500 | - | 246 | WP_273881409.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
PO862_RS19595 (PO862_19595) | 3958585..3959436 | + | 852 | WP_183608609.1 | SDR family NAD(P)-dependent oxidoreductase | - |
PO862_RS19600 (PO862_19600) | 3959521..3960162 | + | 642 | WP_183608608.1 | LysE family translocator | - |
PO862_RS19605 (PO862_19605) | 3960211..3961005 | - | 795 | WP_171604563.1 | ABC transporter ATP-binding protein | - |
PO862_RS19610 (PO862_19610) | 3961002..3961880 | - | 879 | WP_273881407.1 | ABC transporter permease | - |
PO862_RS19615 (PO862_19615) | 3962004..3962957 | - | 954 | WP_273884468.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10880.46 Da Isoelectric Point: 6.7166
>T273374 WP_273884469.1 NZ_CP118687:c3958258-3957968 [Rhizobium sp. MJ22]
MKTLALSPAAADDIDRIYDYTEEKWGQDQAEDYILALRDDCGALAAQTKRGRKIIGLRSGYTALAFRSHFIIYADTEEAL
IVIRILHRRMNIAAHL
MKTLALSPAAADDIDRIYDYTEEKWGQDQAEDYILALRDDCGALAAQTKRGRKIIGLRSGYTALAFRSHFIIYADTEEAL
IVIRILHRRMNIAAHL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|