Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2720227..2720900 | Replicon | chromosome |
Accession | NZ_CP118687 | ||
Organism | Rhizobium sp. MJ22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PO862_RS13675 | Protein ID | WP_272782126.1 |
Coordinates | 2720227..2720640 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PO862_RS13680 | Protein ID | WP_272782124.1 |
Coordinates | 2720637..2720900 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO862_RS13665 (PO862_13665) | 2717637..2718860 | - | 1224 | WP_183608225.1 | efflux RND transporter periplasmic adaptor subunit | - |
PO862_RS13670 (PO862_13670) | 2719116..2720048 | - | 933 | WP_273884229.1 | adenylate/guanylate cyclase domain-containing protein | - |
PO862_RS13675 (PO862_13675) | 2720227..2720640 | - | 414 | WP_272782126.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PO862_RS13680 (PO862_13680) | 2720637..2720900 | - | 264 | WP_272782124.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PO862_RS13685 (PO862_13685) | 2721025..2722575 | - | 1551 | WP_273884230.1 | SpoVR family protein | - |
PO862_RS13690 (PO862_13690) | 2722572..2723846 | - | 1275 | WP_183608222.1 | YeaH/YhbH family protein | - |
PO862_RS13695 (PO862_13695) | 2723859..2725802 | - | 1944 | WP_183608221.1 | PrkA family serine protein kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15027.48 Da Isoelectric Point: 6.7216
>T273373 WP_272782126.1 NZ_CP118687:c2720640-2720227 [Rhizobium sp. MJ22]
MTAWMLDTNIASHVIKGDRPEILKRLAALPMDEIVISSVTEGELLYGLAKRGYPKALSERVRQFLLRVDVLPWDHDVTRA
YGDLRAACEVKGVALAPLEMMIAAHAVATAATLVTRDKAFARVSEPLKLDGWANEGS
MTAWMLDTNIASHVIKGDRPEILKRLAALPMDEIVISSVTEGELLYGLAKRGYPKALSERVRQFLLRVDVLPWDHDVTRA
YGDLRAACEVKGVALAPLEMMIAAHAVATAATLVTRDKAFARVSEPLKLDGWANEGS
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|