Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 109225..109825 | Replicon | plasmid pKNA07 |
| Accession | NZ_CP118676 | ||
| Organism | Komagataeibacter nataicola strain DS12 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LV564_RS17730 | Protein ID | WP_086641428.1 |
| Coordinates | 109481..109825 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LV564_RS17725 | Protein ID | WP_075624185.1 |
| Coordinates | 109225..109488 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV564_RS17685 (LV564_17695) | 104597..104866 | + | 270 | WP_275881615.1 | hypothetical protein | - |
| LV564_RS17690 (LV564_17700) | 105225..105575 | + | 351 | WP_227744513.1 | hypothetical protein | - |
| LV564_RS17695 (LV564_17705) | 105994..106182 | - | 189 | WP_075624223.1 | hypothetical protein | - |
| LV564_RS17700 (LV564_17710) | 106264..106800 | + | 537 | WP_275881616.1 | phosphate-starvation-inducible PsiE family protein | - |
| LV564_RS17705 (LV564_17715) | 107287..107769 | - | 483 | WP_075624222.1 | Hsp20 family protein | - |
| LV564_RS17710 (LV564_17720) | 107805..108086 | - | 282 | WP_075624187.1 | hypothetical protein | - |
| LV564_RS17715 (LV564_17725) | 108247..108348 | + | 102 | WP_124296136.1 | YXWGXW repeat-containing protein | - |
| LV564_RS17720 (LV564_17730) | 108869..109117 | + | 249 | WP_075624186.1 | hypothetical protein | - |
| LV564_RS17725 (LV564_17735) | 109225..109488 | + | 264 | WP_075624185.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LV564_RS17730 (LV564_17740) | 109481..109825 | + | 345 | WP_086641428.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LV564_RS17735 (LV564_17745) | 110061..111143 | - | 1083 | WP_193713792.1 | IS5 family transposase | - |
| LV564_RS17740 (LV564_17750) | 111403..111792 | - | 390 | WP_234448411.1 | Rrf2 family transcriptional regulator | - |
| LV564_RS17745 (LV564_17755) | 111944..112426 | + | 483 | WP_275881617.1 | DUF2938 family protein | - |
| LV564_RS17750 (LV564_17760) | 112431..113360 | - | 930 | WP_193713750.1 | AraC family transcriptional regulator | - |
| LV564_RS17755 (LV564_17765) | 113510..114256 | + | 747 | WP_048839679.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..260483 | 260483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13402.35 Da Isoelectric Point: 9.6204
>T273370 WP_086641428.1 NZ_CP118676:109481-109825 [Komagataeibacter nataicola]
MTEYAIEFDDRALREWDELDGSIRRKFEKKLEKLILNPYSPGNELHGDLAGFYKIKLRQDGYRLVYQIVEQRIVIFIIAV
GRREDNEIYMAATGRVPETPADRTKPSSGKRRIR
MTEYAIEFDDRALREWDELDGSIRRKFEKKLEKLILNPYSPGNELHGDLAGFYKIKLRQDGYRLVYQIVEQRIVIFIIAV
GRREDNEIYMAATGRVPETPADRTKPSSGKRRIR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|