Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 109225..109825 Replicon plasmid pKNA07
Accession NZ_CP118676
Organism Komagataeibacter nataicola strain DS12

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LV564_RS17730 Protein ID WP_086641428.1
Coordinates 109481..109825 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag LV564_RS17725 Protein ID WP_075624185.1
Coordinates 109225..109488 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV564_RS17685 (LV564_17695) 104597..104866 + 270 WP_275881615.1 hypothetical protein -
LV564_RS17690 (LV564_17700) 105225..105575 + 351 WP_227744513.1 hypothetical protein -
LV564_RS17695 (LV564_17705) 105994..106182 - 189 WP_075624223.1 hypothetical protein -
LV564_RS17700 (LV564_17710) 106264..106800 + 537 WP_275881616.1 phosphate-starvation-inducible PsiE family protein -
LV564_RS17705 (LV564_17715) 107287..107769 - 483 WP_075624222.1 Hsp20 family protein -
LV564_RS17710 (LV564_17720) 107805..108086 - 282 WP_075624187.1 hypothetical protein -
LV564_RS17715 (LV564_17725) 108247..108348 + 102 WP_124296136.1 YXWGXW repeat-containing protein -
LV564_RS17720 (LV564_17730) 108869..109117 + 249 WP_075624186.1 hypothetical protein -
LV564_RS17725 (LV564_17735) 109225..109488 + 264 WP_075624185.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
LV564_RS17730 (LV564_17740) 109481..109825 + 345 WP_086641428.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LV564_RS17735 (LV564_17745) 110061..111143 - 1083 WP_193713792.1 IS5 family transposase -
LV564_RS17740 (LV564_17750) 111403..111792 - 390 WP_234448411.1 Rrf2 family transcriptional regulator -
LV564_RS17745 (LV564_17755) 111944..112426 + 483 WP_275881617.1 DUF2938 family protein -
LV564_RS17750 (LV564_17760) 112431..113360 - 930 WP_193713750.1 AraC family transcriptional regulator -
LV564_RS17755 (LV564_17765) 113510..114256 + 747 WP_048839679.1 SDR family oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..260483 260483


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-86)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-70)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13402.35 Da        Isoelectric Point: 9.6204

>T273370 WP_086641428.1 NZ_CP118676:109481-109825 [Komagataeibacter nataicola]
MTEYAIEFDDRALREWDELDGSIRRKFEKKLEKLILNPYSPGNELHGDLAGFYKIKLRQDGYRLVYQIVEQRIVIFIIAV
GRREDNEIYMAATGRVPETPADRTKPSSGKRRIR

Download         Length: 345 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9614.03 Da        Isoelectric Point: 8.7210

>AT273370 WP_075624185.1 NZ_CP118676:109225-109488 [Komagataeibacter nataicola]
MSAVTFRVDDALKSAAVAKLSAHGLSLSDVLRDTLAYIAETGQPPVKRRLVTDEDARLIEIVRERLANPAPRHRMTLADL
KARHPDD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References