Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2505134..2505769 | Replicon | chromosome |
Accession | NZ_CP118675 | ||
Organism | Komagataeibacter nataicola strain DS12 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LV564_RS12620 | Protein ID | WP_275881235.1 |
Coordinates | 2505134..2505544 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G2I1D7 |
Locus tag | LV564_RS12625 | Protein ID | WP_010511771.1 |
Coordinates | 2505545..2505769 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LV564_RS12605 (LV564_12615) | 2501019..2503928 | - | 2910 | WP_075596346.1 | AAA family ATPase | - |
LV564_RS12610 (LV564_12620) | 2504092..2504358 | + | 267 | WP_239016082.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
LV564_RS12615 (LV564_12625) | 2504339..2504728 | + | 390 | WP_075596344.1 | type II toxin-antitoxin system VapC family toxin | - |
LV564_RS12620 (LV564_12630) | 2505134..2505544 | - | 411 | WP_275881235.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LV564_RS12625 (LV564_12635) | 2505545..2505769 | - | 225 | WP_010511771.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LV564_RS12630 (LV564_12640) | 2505949..2506374 | + | 426 | WP_275881236.1 | hypothetical protein | - |
LV564_RS12635 (LV564_12645) | 2506401..2506658 | - | 258 | WP_275881237.1 | hypothetical protein | - |
LV564_RS12640 (LV564_12650) | 2506692..2507627 | - | 936 | WP_275881238.1 | recombinase family protein | - |
LV564_RS12645 (LV564_12655) | 2507576..2507944 | - | 369 | WP_275881239.1 | recombinase family protein | - |
LV564_RS12650 (LV564_12660) | 2508418..2510298 | + | 1881 | WP_275881240.1 | hypothetical protein | - |
LV564_RS12655 (LV564_12665) | 2510385..2510705 | + | 321 | WP_275881241.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15465.65 Da Isoelectric Point: 6.7161
>T273369 WP_275881235.1 NZ_CP118675:c2505544-2505134 [Komagataeibacter nataicola]
MLRYLLDTNLCIRVLRDRPQGLRPRFNSCAEELSLSDVVLYELLYGAERSSDPVRTRREVEHFAARLAVLPFDSEAAAHT
ADIRAALERNGRIIGPYDLMIAGHARSRGLIVVTGNLREFQRVEGLRTEDWLTDTV
MLRYLLDTNLCIRVLRDRPQGLRPRFNSCAEELSLSDVVLYELLYGAERSSDPVRTRREVEHFAARLAVLPFDSEAAAHT
ADIRAALERNGRIIGPYDLMIAGHARSRGLIVVTGNLREFQRVEGLRTEDWLTDTV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|