Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 2365307..2365847 | Replicon | chromosome |
Accession | NZ_CP118675 | ||
Organism | Komagataeibacter nataicola strain DS12 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | LV564_RS12125 | Protein ID | WP_275881213.1 |
Coordinates | 2365548..2365847 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | LV564_RS12120 | Protein ID | WP_275881212.1 |
Coordinates | 2365307..2365561 (+) | Length | 85 a.a. |
Genomic Context
Location: 2360681..2361253 (573 bp)
Type: Others
Protein ID: WP_141262432.1
Type: Others
Protein ID: WP_141262432.1
Location: 2361650..2361919 (270 bp)
Type: Others
Protein ID: WP_141262431.1
Type: Others
Protein ID: WP_141262431.1
Location: 2362263..2362628 (366 bp)
Type: Others
Protein ID: WP_275881211.1
Type: Others
Protein ID: WP_275881211.1
Location: 2362625..2363002 (378 bp)
Type: Others
Protein ID: WP_141262429.1
Type: Others
Protein ID: WP_141262429.1
Location: 2363070..2363627 (558 bp)
Type: Others
Protein ID: WP_141262428.1
Type: Others
Protein ID: WP_141262428.1
Location: 2365307..2365561 (255 bp)
Type: Antitoxin
Protein ID: WP_275881212.1
Type: Antitoxin
Protein ID: WP_275881212.1
Location: 2365548..2365847 (300 bp)
Type: Toxin
Protein ID: WP_275881213.1
Type: Toxin
Protein ID: WP_275881213.1
Location: 2364093..2364575 (483 bp)
Type: Others
Protein ID: WP_141262426.1
Type: Others
Protein ID: WP_141262426.1
Location: 2365876..2366142 (267 bp)
Type: Others
Protein ID: WP_275881214.1
Type: Others
Protein ID: WP_275881214.1
Location: 2366139..2367347 (1209 bp)
Type: Others
Protein ID: WP_275881215.1
Type: Others
Protein ID: WP_275881215.1
Location: 2367344..2368345 (1002 bp)
Type: Others
Protein ID: WP_275881216.1
Type: Others
Protein ID: WP_275881216.1
Location: 2368342..2369025 (684 bp)
Type: Others
Protein ID: WP_275881217.1
Type: Others
Protein ID: WP_275881217.1
Location: 2369031..2370416 (1386 bp)
Type: Others
Protein ID: WP_275881218.1
Type: Others
Protein ID: WP_275881218.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LV564_RS12090 (LV564_12100) | 2360681..2361253 | + | 573 | WP_141262432.1 | hypothetical protein | - |
LV564_RS12095 (LV564_12105) | 2361650..2361919 | + | 270 | WP_141262431.1 | hypothetical protein | - |
LV564_RS12100 (LV564_12110) | 2362263..2362628 | + | 366 | WP_275881211.1 | hypothetical protein | - |
LV564_RS12105 (LV564_12115) | 2362625..2363002 | + | 378 | WP_141262429.1 | hypothetical protein | - |
LV564_RS12110 (LV564_12120) | 2363070..2363627 | + | 558 | WP_141262428.1 | phosphate-starvation-inducible PsiE family protein | - |
LV564_RS12115 (LV564_12125) | 2364093..2364575 | - | 483 | WP_141262426.1 | Hsp20 family protein | - |
LV564_RS12120 (LV564_12130) | 2365307..2365561 | + | 255 | WP_275881212.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
LV564_RS12125 (LV564_12135) | 2365548..2365847 | + | 300 | WP_275881213.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LV564_RS12130 (LV564_12140) | 2365876..2366142 | - | 267 | WP_275881214.1 | DUF2274 domain-containing protein | - |
LV564_RS12135 (LV564_12145) | 2366139..2367347 | - | 1209 | WP_275881215.1 | TrbI/VirB10 family protein | - |
LV564_RS12140 (LV564_12150) | 2367344..2368345 | - | 1002 | WP_275881216.1 | P-type conjugative transfer protein TrbG | - |
LV564_RS12145 (LV564_12155) | 2368342..2369025 | - | 684 | WP_275881217.1 | conjugal transfer protein TrbF | - |
LV564_RS12150 (LV564_12160) | 2369031..2370416 | - | 1386 | WP_275881218.1 | P-type conjugative transfer protein TrbL | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11503.24 Da Isoelectric Point: 7.0612
>T273368 WP_275881213.1 NZ_CP118675:2365548-2365847 [Komagataeibacter nataicola]
MPTCRKTRLSEDDIIGIYMQGVREFGPRQAEAYHAGLADTFDLIALHPQLAPERREFAPPIRLHRHQAHHILYLIDDDGV
LIVRVLPRLQRWERLVGTD
MPTCRKTRLSEDDIIGIYMQGVREFGPRQAEAYHAGLADTFDLIALHPQLAPERREFAPPIRLHRHQAHHILYLIDDDGV
LIVRVLPRLQRWERLVGTD
Download Length: 300 bp