Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 7129..7760 | Replicon | chromosome |
Accession | NZ_CP118675 | ||
Organism | Komagataeibacter nataicola strain DS12 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LV564_RS01200 | Protein ID | WP_182999298.1 |
Coordinates | 7368..7760 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LV564_RS01195 | Protein ID | WP_275881357.1 |
Coordinates | 7129..7371 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LV564_RS01185 (LV564_01190) | 2749..4290 | - | 1542 | WP_275881355.1 | DNA cytosine methyltransferase | - |
LV564_RS01190 (LV564_01195) | 4899..6899 | - | 2001 | WP_275881356.1 | DNA topoisomerase III | - |
LV564_RS01195 (LV564_01200) | 7129..7371 | + | 243 | WP_275881357.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LV564_RS01200 (LV564_01205) | 7368..7760 | + | 393 | WP_182999298.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LV564_RS01205 (LV564_01210) | 7820..8203 | - | 384 | WP_275881358.1 | single-stranded DNA-binding protein | - |
LV564_RS01210 (LV564_01215) | 8200..9207 | - | 1008 | WP_275881359.1 | site-specific DNA-methyltransferase | - |
LV564_RS01215 (LV564_01220) | 9204..9713 | - | 510 | WP_275881360.1 | DUF3158 family protein | - |
LV564_RS01220 (LV564_01225) | 9854..10528 | - | 675 | Protein_9 | TIGR03761 family integrating conjugative element protein | - |
LV564_RS01225 (LV564_01230) | 11199..11576 | + | 378 | WP_182999301.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14488.54 Da Isoelectric Point: 6.9894
>T273367 WP_182999298.1 NZ_CP118675:7368-7760 [Komagataeibacter nataicola]
VKYLLDSNAVIALLKGHPGFLSRLHQHTPSDFGLSAIVTHELYYGAYKGSRRAENLARVDALRFAVLEFDREDSLRAGEL
RALLAQAGTPIGPLDVLIAGQAWARGLILITHNVREFQRVAQIQVEDWQD
VKYLLDSNAVIALLKGHPGFLSRLHQHTPSDFGLSAIVTHELYYGAYKGSRRAENLARVDALRFAVLEFDREDSLRAGEL
RALLAQAGTPIGPLDVLIAGQAWARGLILITHNVREFQRVAQIQVEDWQD
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|