Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 87987..88657 Replicon plasmid pKNA08
Accession NZ_CP118673
Organism Komagataeibacter nataicola strain DS12

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LV564_RS00740 Protein ID WP_275881116.1
Coordinates 88235..88657 (+) Length 141 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag LV564_RS00735 Protein ID WP_275881115.1
Coordinates 87987..88238 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV564_RS00710 (LV564_00710) 83143..83376 - 234 WP_275881112.1 conjugal transfer protein TraD -
LV564_RS00715 (LV564_00715) 83441..83800 - 360 WP_275881150.1 conjugal transfer protein TraD -
LV564_RS00720 (LV564_00720) 83897..86980 + 3084 WP_275881151.1 Ti-type conjugative transfer relaxase TraA -
LV564_RS00725 (LV564_00725) 87035..87229 + 195 WP_275881113.1 type II toxin-antitoxin system VapB family antitoxin -
LV564_RS00730 (LV564_00730) 87226..87618 + 393 WP_275881114.1 PIN domain nuclease -
LV564_RS00735 (LV564_00735) 87987..88238 + 252 WP_275881115.1 plasmid stabilization protein Antitoxin
LV564_RS00740 (LV564_00740) 88235..88657 + 423 WP_275881116.1 type II toxin-antitoxin system VapC family toxin Toxin
LV564_RS00745 (LV564_00745) 88657..89325 + 669 WP_275881117.1 DUF6118 family protein -
LV564_RS00750 (LV564_00750) 89409..90475 + 1067 WP_275881118.1 IS630 family transposase -
LV564_RS00755 (LV564_00755) 90513..90920 - 408 WP_275881119.1 Rrf2 family transcriptional regulator -
LV564_RS00760 (LV564_00760) 90920..91189 - 270 WP_275881120.1 hypothetical protein -
LV564_RS00765 (LV564_00765) 91528..91914 - 387 WP_275881121.1 type II toxin-antitoxin system VapC family toxin -
LV564_RS00770 (LV564_00770) 91911..92156 - 246 WP_275881122.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
LV564_RS00775 (LV564_00775) 92544..93197 + 654 WP_275881123.1 invasion associated locus B family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..146450 146450


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-122)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 141 a.a.        Molecular weight: 15206.44 Da        Isoelectric Point: 4.9371

>T273366 WP_275881116.1 NZ_CP118673:88235-88657 [Komagataeibacter nataicola]
MILLDTNVISEPWKPAPEPRVLAWIDAQAIETLFLSAVTVAELRFGIGAMPAGRRRSVLHERLEQDVLPLFEGRVLSFDL
AASQAYAELMVRARSEGRAIGKADGYIAAAAASRGYAVASRDVSPFEAAGVRVLNPWEDV

Download         Length: 423 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.40 Da        Isoelectric Point: 7.2056

>AT273366 WP_275881115.1 NZ_CP118673:87987-88238 [Komagataeibacter nataicola]
MSSVVIRNLPEETHRALKAQAMLHGRSTEAEIRTILEAAVRPSQRVRLGSLLASIGREAGVRDQDIAALQTRDQTPAEPM
SFE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References